<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP03059

Description Uncharacterized protein
SequenceMSDEEHHFESSDAGASKTYPQQAGNIRKGGHIVIKGRPCKVVEVSTSKTGKHGHAKCHFVAIDIFTAKKLEDIVPSSHNCDVPHVNRIDYQLIDISEDGFVSLLTDSGGTKDDLKLPTDDNLSALMKSGFEEGKDVVVSVMSSMGEEQICAVKEVGGGNSWVKKEDSKSKIGCKPLEEFLCCRLPCRVSLREFGSSTSIYPIGMLYSTFSSNVQDLLHISSPTSLLQVHPTSDLDVAKQSAAPSLLSASLQTSNVKGAVLVGLAFSVALANSIIICNTAGVVSVLEVISGAGALVRASDMIKEQVEVVMDEGRQKDLQLLEEIIDKGLKQKLLQTIASRSDLRKNLETLEKNGVNSLKTMVNLGSEVYMQAEVLDTRHIFMDVGLGFYVEFTRQEALDYIPKREELVKKQLEEVTKVIAQIKGRIKLAHHQIQQILNLPDENPSSHRQPVMDPAQNKSAAGIGGSNGTTTMGYQTNDGTATASEDSKENLNQVINSIQKTLGLLHQLHLTVSSFTPASQLHLLQRLNSLVSELNSMTKLSEKCNIQVPMEVLSLIDDGKNPDEFTRDVINSCVARNQVTKGKTDAFKDLRKHILEELEETFPDEVDKYREIRAASAAISIEFSRRERKMSEVFEGYERQYCELSTNLSRKCHSASLLSHGEEKKEKLVEIKSGMDEADVLIRKMDLEARSLQPSAKAVCLSKLREYKSDLNQLKKEFKRVSSPDANQSTREELMESGMADVHAVSADQSGRLAMSMERLDQSSDRIRESRRLMLETEEVGISVVENLSQQRQTLLHAHSKLQGVDDAIDKSKKVLTAMSRRMTRNKWIVGSVIVALILAIILIISYKLSH
Length850
PositionMiddle
OrganismBrassica oleracea var. oleracea
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
Aromaticity0.04
Grand average of hydropathy-0.327
Instability index42.88
Isoelectric point6.16
Molecular weight94018.23
Publications
PubMed=24916971

Function

Annotated function Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. 
ECO:0000256	ARBA:ARBA00003430
GO - Cellular Component
integral component of membrane	GO:0016021	IEA:UniProtKB-KW
mediator complex	GO:0016592	IEA:InterPro
prefoldin complex	GO:0016272	IEA:InterPro
GO - Biological Function
ribosome binding	GO:0043022	IEA:InterPro
transcription coregulator activity	GO:0003712	IEA:InterPro
translation elongation factor activity	GO:0003746	IEA:InterPro
unfolded protein binding	GO:0051082	IEA:InterPro
GO - Biological Process
intracellular protein transport	GO:0006886	IEA:InterPro
positive regulation of translational elongation	GO:0045901	IEA:InterPro
positive regulation of translational termination	GO:0045905	IEA:InterPro
protein folding	GO:0006457	IEA:InterPro
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro
vesicle-mediated transport	GO:0016192	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP03059
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     590.31|     197|     367|       3|     219|       1
---------------------------------------------------------------------------
    3-  219 (305.59/286.11)	DEEHHFESSDAGASKTYPQQAG..NIRKGGHIVIKgrpcKVVEVSTSKTGKHGHAK.CHFVAIDIFtakKLEDIVPSSHNCDV..PHVNRiDYQLIDISeDGFVSL..LTDSG..GTKDDLKLPTDDNLSALMKS.GFEEGKDVVVSVMSSMGeeQICAVKEVgggNSWVKKEDSKSKIGCKpleeflC.CRLPCRV.SLREFGSSTSIYPIGMLYSTFSSN.........VQDL.LHI
  375-  593 (284.71/211.68)	DTRHIFMDVGLGFYVEFTRQEAldYIPKREELVKK....QLEEVTKVIAQIKGRIKlAHHQIQQIL...NLPDENPSSHRQPVmdPAQNK.SAAGIGGS.NGTTTMgyQTNDGtaTASEDSKENLNQVINSIQKTlGLLHQLHLTVSSFTPAS..QLHLLQRL...NSLVSELNSMTKLSEK......CnIQVPMEVlSLIDDGKNPDEFTRDVINSCVARNqvtkgktdaFKDLrKHI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.83|      15|      19|     748|     766|       2
---------------------------------------------------------------------------
  748-  762 (25.56/22.14)	QSGRLAMSMERLDQS
  768-  782 (24.27/ 9.40)	ESRRLMLETEEVGIS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.64|      17|     107|     682|     702|       3
---------------------------------------------------------------------------
  682-  698 (26.48/21.58)	RKMDLEARSLQPSAKAV
  704-  720 (27.16/11.01)	REYKSDLNQLKKEFKRV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.42|      21|     481|     317|     339|       4
---------------------------------------------------------------------------
  317-  339 (28.86/24.78)	LQLLEEIIDKGlkQKLLQTIASR
  801-  821 (34.56/22.85)	LQGVDDAIDKS..KKVLTAMSRR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP03059 with Med10 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LNLPDENPSSHRQPVMDPAQNKSAAGIGGSNGTTTMGYQTNDGTATASEDSKENLN
436
491










Molecular Recognition Features






MoRF SequenceStartStop




NANANA