<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02990
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MSSPEEMDDTSEPPPSPPKNTYNDPDGGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLYFLELLQNPNFRTAMAHPANKELAHRQQFYYWKNYRNNRLKHILPRPLPEPVAPQPPASLPPAPSAPAAPSPAPSPMQYSNMLPKNETRNMVSAGIDRRKRKKGP |
| Length | 192 |
| Position | Middle |
| Organism | Brassica oleracea var. oleracea |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.859 |
| Instability index | 74.36 |
| Isoelectric point | 9.13 |
| Molecular weight | 22423.34 |
| Publications | PubMed=24916971
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02990
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.57| 20| 27| 32| 51| 1
---------------------------------------------------------------------------
32- 51 (36.56/23.88) FLLELEFVQCLANPTYIHYL
62- 81 (39.01/25.94) FIGYLKYLQYWQRPEYIKFI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 88.59| 25| 26| 87| 111| 2
---------------------------------------------------------------------------
87- 111 (41.94/25.89) LYFLELLQNPNFRTAMAHPANKELA
116- 140 (46.64/29.66) FYYWKNYRNNRLKHILPRPLPEPVA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.02| 19| 151| 13| 31| 3
---------------------------------------------------------------------------
13- 31 (41.82/16.36) PPPSP.......PKN.TYNDPDGGRQR
159- 185 (27.20/ 8.63) PAPSPmqysnmlPKNeTRNMVSAGIDR
---------------------------------------------------------------------------
|