<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02989
Description |
Uncharacterized protein |
Sequence | LQKEGFLSTWTNSFVGPWDPSQGLYNPDEQINLWLFLPGRHSSISDTAQAAVSKLRDVIFGFAFVKVARAILENPTDKTKVHLIYANGTYDDVLLRVQRCTSFKIYYPPETWDGGVGFVSKDMIQAHCPAPASDIQVIPYPLFFLILNIPDHHFF |
Length | 155 |
Position | Kinase |
Organism | Brassica oleracea var. oleracea |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.027 |
Instability index | 30.34 |
Isoelectric point | 5.90 |
Molecular weight | 17561.84 |
Publications | PubMed=24916971
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | oxidoreductase activity GO:0016491 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02989
No repeats found
|