<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02982
Description |
Uncharacterized protein |
Sequence | MPIVASLWTQKAKRWFDFLVFSASRTVFLHNPDAVVQLLRNCFSATLGLNVNDGGVGALLGHGGIFPVAPGILYLRMYRALRDTVSVTEEIFSLLIHSVKDIAQNRLSKEDLERLKTVKSGSRYGQSSLATAMTQVKLAASLSASLVWLTGGLGMVHLLIKETIPSWFLSVDKSDQEQGPSELVAEL |
Length | 187 |
Position | Tail |
Organism | Brassica oleracea var. oleracea |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.225 |
Instability index | 35.34 |
Isoelectric point | 8.76 |
Molecular weight | 20458.49 |
Publications | PubMed=24916971
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02982
No repeats found
|