<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02981
| Description |
Uncharacterized protein |
| Sequence | MRRIRLGRGLEISCLKTPPRNHGKPLGVLSECLGWENISGMRDSNVAGLYYRFGESNGELFAMLGDREVLKSLSNGLRQWGKDELAILLISMGGIETMDHATDFIIHLNAS |
| Length | 111 |
| Position | Tail |
| Organism | Brassica oleracea var. oleracea |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Brassiceae> Brassica.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.167 |
| Instability index | 36.67 |
| Isoelectric point | 6.82 |
| Molecular weight | 12317.08 |
| Publications | PubMed=24916971
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02981
No repeats found
|