<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02970
| Description |
Mediator-RNA polymerase II transcription subunit 21 |
| Sequence | MGDRLTQLQDAVDQLATQFVACLHYVNKRHDLETLGPNDKVREVKDAPKEVDSLPPDEFRAGMVELSQDLIVKEQQIEVLISSLPGLDNSEMDQERYIKELEEDLKIAEAQRQEAIKEKDQILSELDSVIRSIRRP |
| Length | 136 |
| Position | Middle |
| Organism | Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) (Fusarium vascular wilt of tomato) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium oxysporum species complex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.638 |
| Instability index | 56.82 |
| Isoelectric point | 4.58 |
| Molecular weight | 15597.42 |
| Publications | PubMed=20237561
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02970
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.44| 12| 33| 65| 76| 1
---------------------------------------------------------------------------
65- 76 (20.05/11.75) ELSQDLIVKEQQ
100- 111 (19.39/11.17) ELEEDLKIAEAQ
---------------------------------------------------------------------------
|