<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02961
Description |
Uncharacterized protein |
Sequence | MDTSTPTNLMDKHQKIISEILRSYRDLMNCVTVNGMDKEKQGDYEAQANKLNYRDPDTMAAAGLRTQRKFDELYESIKELLALTRTIKELWVFGPVDRADEHRKEKEEQIDRDVAEITTLFNKIDANAMRELAEKNGGTWESQGEAAATAPPAAAAPPATTTAQAPGAPAPTGN |
Length | 174 |
Position | Head |
Organism | Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) (Fusarium vascular wilt of tomato) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium oxysporum species complex.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.744 |
Instability index | 25.84 |
Isoelectric point | 4.97 |
Molecular weight | 19237.30 |
Publications | PubMed=20237561
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02961
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.39| 21| 27| 24| 45| 1
---------------------------------------------------------------------------
24- 45 (35.70/23.43) YRDlMNCVTVNGMDKEKQGD..YE
53- 75 (33.70/17.98) YRD.PDTMAAAGLRTQRKFDelYE
---------------------------------------------------------------------------
|