<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02945
| Description |
Uncharacterized protein |
| Sequence | MDAGGNKFGGGPRELSGVVDLISRYKLLPHHDFFCKRPLPLSIADTHYLHNVAGDTEIRKGEGMQLDQLNQNTSHNRDTNARIQPFDFDILKEAFQLRETTPVELPPTEKGMPTIAGKSKGEVKDKERKHKKHKDRDKEKDKEHKKHKHCHKDKDRSKDKDKEKKKDRSGHHGSGADHLKKHHEKKRKHDGDEVRNDINRHKKSKSKLVN |
| Length | 210 |
| Position | Head |
| Organism | Gossypium raimondii (New World cotton) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.537 |
| Instability index | 34.21 |
| Isoelectric point | 9.66 |
| Molecular weight | 24266.08 |
| Publications | PubMed=23257886
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02945
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.77| 13| 15| 124| 137| 1
---------------------------------------------------------------------------
124- 137 (20.63/10.26) KDKERKHKKHkDRD
180- 192 (22.15/ 7.14) KKHHEKKRKH.DGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.10| 15| 17| 138| 152| 2
---------------------------------------------------------------------------
138- 152 (30.07/11.28) KEKDKEHKKHKHCHK
158- 172 (28.03/10.10) KDKDKEKKKDRSGHH
---------------------------------------------------------------------------
|