| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MQSIHPLDISQLSKMTGIEYMLSEVMEPHLFIIRKQKRDSAEKVTPMLAYYILDGSIYQAPQLCNVFAARVGRALYYISKAFTTAASKLEKIGYGDTENESETSEPKGGKETIDFKEVKRVDHILASLQRKLPPAPPPPPFPDGFVPPTTEAEKEPENQQTTEPQPPAVDPIIDQGPAKRMKF |
| Length | 183 |
| Position | Head |
| Organism | Gossypium raimondii (New World cotton) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.541 |
| Instability index | 58.85 |
| Isoelectric point | 5.69 |
| Molecular weight | 20473.23 |
| Publications | PubMed=23257886 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP02943
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.13| 11| 24| 41| 52| 1
---------------------------------------------------------------------------
41- 52 (16.93/15.67) AEKVTPMLaYYI
68- 78 (20.20/13.16) AARVGRAL.YYI
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DPIIDQGPAKRMKF 2) FKEVKRVDHILASLQRKLP | 170 115 | 183 133 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab