<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02917
| Description |
Uncharacterized protein |
| Sequence | MDAGGNKFGGDTHYLHNVAGDTEIRKGEGMQLDQLNQNTSHNRDTNARIQPFDFDILKEAFQLRETTPVELPPTEKGMPTIAGKSKGEVKDKERKHKKHKDRDKEKDKEHKKHKHCHKDKDRSKDKDKEKKKDRSGHHGSGADHLKKHHEKKRKHDGDEVRNDINRHKKSKSKLVN |
| Length | 176 |
| Position | Head |
| Organism | Gossypium raimondii (New World cotton) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.839 |
| Instability index | 35.06 |
| Isoelectric point | 9.65 |
| Molecular weight | 20408.55 |
| Publications | PubMed=23257886
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02917
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.56| 15| 18| 104| 118| 2
---------------------------------------------------------------------------
104- 118 (29.02/11.45) KEKDKEHKKHKHCHK
124- 138 (25.07/ 8.79) KDKDKEKKKDRSGHH
142- 156 (23.47/ 7.71) ADHLKKHHEKKRKHD
---------------------------------------------------------------------------
|