<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02891
| Description |
Uncharacterized protein |
| Sequence | MDTNNWRSTPPSGEPTTDTGDWRTQLQPDSRQRIINKIMETFMRHLPFSGQDGLNELRKIAVRFEEKIFTAATSQSDYLKRISLKMLTVEIKSQNTVPNTRDNSIPPDPGHAEPSSQSRAINSYLFTK |
| Length | 128 |
| Position | Tail |
| Organism | Gossypium raimondii (New World cotton) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.871 |
| Instability index | 52.85 |
| Isoelectric point | 9.10 |
| Molecular weight | 14624.22 |
| Publications | PubMed=23257886
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02891
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.59| 15| 20| 28| 46| 1
---------------------------------------------------------------------------
28- 42 (27.95/23.39) PDSRQRIIN...KIMETF
47- 64 (22.64/ 8.30) PFSGQDGLNelrKIAVRF
---------------------------------------------------------------------------
|