<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02856
| Description |
Uncharacterized protein |
| Sequence | MQPPGTDMTGICFRDQLWLNTYPLDRNLIFDYFALSPFYDWTCNNEKLRMQSIHPLDISQLSKMTGIEYMLSEVMEPHLFIIRKQKRDSAEKVTPMLAYYILDGSIYQAPQLCNVFAARVGRALYYISKAFTTAASKLEKIGYGDTENESETSEPKGGKETIDFKEVKRVDHILASLQRKLPPAPPPPPFPDGFVPPTTEAEKEPENQQTTEPQPPAVDPIIDQGPAKRMKF |
| Length | 232 |
| Position | Head |
| Organism | Gossypium raimondii (New World cotton) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.523 |
| Instability index | 56.07 |
| Isoelectric point | 5.35 |
| Molecular weight | 26376.89 |
| Publications | PubMed=23257886
PubMed=30476109
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02856
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.46| 24| 57| 145| 169| 1
---------------------------------------------------------------------------
145- 169 (36.80/31.03) DTENEsETSEPK..GGKETIDFKEVKR
204- 229 (38.66/27.29) EPENQ.QTTEPQppAVDPIIDQGPAKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.65| 16| 30| 4| 25| 2
---------------------------------------------------------------------------
4- 21 (27.54/16.84) PGTDMTgiCFRDQLWLNT
37- 52 (32.11/18.11) PFYDWT..CNNEKLRMQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.13| 11| 24| 90| 101| 3
---------------------------------------------------------------------------
90- 101 (16.93/17.32) AEKVTPMLaYYI
117- 127 (20.20/14.57) AARVGRAL.YYI
---------------------------------------------------------------------------
|