<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02853
Description |
Uncharacterized protein |
Sequence | MDTNNWRSTPPSGEPTTDTGDWRTQLQPDSRQRIINKIMETFMRHLPFSGQDGLNELRKIAVRFEEKIFTAATSQSDYLKRISLKMLTVEIKSQNTVPNTRDNSIPPDPGSQGMQNQVHSQGQSIPISLQSNQSQAQLLPQSVPNNMASAGVQSSAGLQSEMPAVSGLTLSPVSDVVEQHE |
Length | 181 |
Position | Tail |
Organism | Gossypium raimondii (New World cotton) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.681 |
Instability index | 66.14 |
Isoelectric point | 5.61 |
Molecular weight | 19944.01 |
Publications | PubMed=23257886
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02853
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.03| 16| 17| 123| 138| 1
---------------------------------------------------------------------------
103- 120 (23.53/12.02) NSIPpdPGSQGM..QNQVHS
123- 138 (27.86/15.47) QSIP..ISLQSN..QSQAQL
141- 158 (21.64/10.51) QSVP..NNMASAgvQSSAGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.87| 11| 15| 2| 12| 2
---------------------------------------------------------------------------
2- 12 (23.93/12.10) DTNNWRS..TPPS
18- 30 (18.95/ 8.44) DTGDWRTqlQPDS
---------------------------------------------------------------------------
|