<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02847

Description Uncharacterized protein
SequenceMVNLELFNIVDEIKKVSKAFVVHPKNVNADNAPILPVMLSSKLLPEMEVEDNLKREQLLLGMQNLPIPSQIDKLKARIDMIAAACESAEKVLADTRKAYCFFSRQGPAILPTLDKGQAAKIQEQENLLRTAVNFGEGLRLPADQKLITPSLPLHLVDIMPAADGVQSFADPSGMYMKNTPLMSNNIGSQGSLLQATGAQLIGRSAASPSAATSATSYDNTTTSPLPYANSPRSATTMMNTPSPQQQTQQLQQQQQHQQQQQQQQQRQKMMQLPQHQQQLLAQQQFRQSTMHGLGQNQLPLHDLQGQTQQKFQSLHGQMQFSQPLGHQQFQGRQLPPGHVQHGIGQSQLNQGNQLSRHLGQFSSAANTALFNAAQGTPSTQMIPNMSATMSSQSLLPRMQFVPGSNPQRTHASQILSDQMFNMGSNPGGLMAMQPQPQQQQQQSQQQHGSQAAFGNMGTAQNLQSNMAALQNNPNFAQQRQQNQQ
Length484
PositionHead
OrganismGossypium raimondii (New World cotton)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
Aromaticity0.04
Grand average of hydropathy-0.638
Instability index63.85
Isoelectric point9.34
Molecular weight53210.47
Publications
PubMed=23257886

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02847
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.08|      18|      18|     377|     394|       2
---------------------------------------------------------------------------
  377-  392 (23.89/ 6.09)	...PSTQMIPNMSATMSSQ
  427-  445 (24.60/ 6.47)	GGlMAMQPQPQQQQQQSQQ
  446-  463 (26.59/ 7.55)	QH.GSQAAFGNMGTAQNLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.25|      14|      18|     207|     224|       4
---------------------------------------------------------------------------
  207-  224 (18.12/21.21)	SPSaatSATSYDNtTTSP
  230-  243 (29.14/17.14)	SPR...SATTMMN.TPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.63|      12|      21|     394|     406|       5
---------------------------------------------------------------------------
  394-  406 (20.68/14.52)	LLPRMqFVPGSNP
  415-  426 (24.95/12.96)	LSDQM.FNMGSNP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.95|      17|      23|     273|     291|       7
---------------------------------------------------------------------------
  273-  291 (26.38/16.86)	PQHQQQLLAQQQFrQStMH
  299-  315 (31.56/12.35)	PLHDLQGQTQQKF.QS.LH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02847 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GAQLIGRSAASPSAATSATSYDNTTTSPLPYANSPRSATTMMNTPSPQQQTQQLQQQQQHQQQQQQQQQRQKMMQLPQHQQQLLAQQQFRQSTMHGLGQNQLPLHDLQGQTQQKFQSLHGQMQFSQPLGHQQFQGRQLPPGHVQHGIGQSQLNQGNQLSRHLGQFSSAANTALFNAAQGTPSTQMIPNMSATMSSQSLLPRMQFVPGSNPQRTHASQILSDQMFNMGSNPGGLMAMQPQPQQQQQQSQQQHGSQAAFGNMGTAQNLQSNMAALQNNPNFAQQRQQNQQ
197
484










Molecular Recognition Features






MoRF SequenceStartStop




NANANA