<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02828
| Description |
Uncharacterized protein |
| Sequence | MQLDQLIQNTSHNRDSNVRIQPFDLDILKEAFQLSETTPVELSVSEKGIPTIAGKSKSEAKDKDRKHKKHKDRDKDKDKEHKKHKHRHKDKDRSKDKDKEKKKDRSGHHDSGADHSKKHHEKKRKHDGDEDLSDVHRHKKSKHKSSKIDEVGAIKVAG |
| Length | 158 |
| Position | Head |
| Organism | Gossypium raimondii (New World cotton) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.01 |
| Grand average of hydropathy | -1.829 |
| Instability index | 32.92 |
| Isoelectric point | 9.66 |
| Molecular weight | 18342.25 |
| Publications | PubMed=23257886
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02828
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.04| 15| 15| 62| 76| 1
---------------------------------------------------------------------------
62- 76 (28.15/ 7.76) DKDRKHKKHKDRDKD
78- 92 (27.89/ 7.62) DKEHKKHKHRHKDKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.81| 16| 19| 108| 126| 2
---------------------------------------------------------------------------
109- 124 (31.08/ 8.94) HDSGADHSKKHHEKKR
126- 141 (28.73/ 8.45) HDGDEDLSDVHRHKKS
---------------------------------------------------------------------------
|