<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02822
| Description |
Uncharacterized protein |
| Sequence | MLDEWSSNILQHDPMLLYRHKRDGNHRSVTSKYEILGFISSGTYGRVYKARSLSEGGTIHAIKKFKPDKEGDVITYTGISQSAIREIALNREIDHENIVALKEVILEDKSIYMVFEYAEHDFLQVIHHHSQTLRASITLTVLKSLTYQLLNGLVYLHSCHILHRDLKPANILITSAGVVKIGDLGLARLIYEPLQPLFAGDKVVVTIWYRAPELLMGAKHYTKAIDCWAVGCVLAELASLRPIFKGEEAKLDSKKNVPFQRDQLLKIFEVLGTPDENDWPGVVHMPEYQSMKRLDHFQSQLVGWCNSRIRGPQGYDLMRRLFMYDPDTRLTAKDALQHKWFQDEPKPTWNAFQTIPQQQIPPHRRITQDEAPSMMPVPQHMSQQGVGHAHMVAFGQSQSKPGSSASFASLSGGGGHYGAQSGGNGRKKARLG |
| Length | 432 |
| Position | Kinase |
| Organism | Hypholoma sublateritium FD-334 SS-4 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Strophariaceae> Hypholoma.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.363 |
| Instability index | 50.29 |
| Isoelectric point | 8.91 |
| Molecular weight | 48728.28 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02822
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.12| 19| 26| 381| 400| 2
---------------------------------------------------------------------------
381- 400 (30.97/21.59) MSQQGvGHAHMVAFGQSQSK
410- 428 (35.16/20.27) LSGGG.GHYGAQSGGNGRKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.78| 16| 19| 317| 334| 3
---------------------------------------------------------------------------
317- 332 (28.43/19.43) LMRRLFMYDPDTRLTA
336- 351 (32.35/15.84) LQHKWFQDEPKPTWNA
---------------------------------------------------------------------------
|