<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02812
| Description |
Uncharacterized protein |
| Sequence | MRRVYTRKSMSEYDPRLIAPTCLYLASKAEESTVQARLLVFYIKKLNSDEKYRYEIKEILEMEMKILEALNYYLVVFHPYRTLAQLLQDAGINDMSMTQLSWGLVNDTYKMDLILIHPPYLIALACMYIASVHREKDITTWFEELHVDMNVVKNISMEILDFYENYKISDERINAAFSKLDFKP |
| Length | 184 |
| Position | Kinase |
| Organism | Gossypium raimondii (New World cotton) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.143 |
| Instability index | 38.45 |
| Isoelectric point | 5.62 |
| Molecular weight | 21819.18 |
| Publications | PubMed=23257886
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02812
No repeats found
|