<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02805
Description |
Uncharacterized protein |
Sequence | MDPEGKKFGGGPRELSGAVDLISHYKLLPHHDFFCKRPLPVSISDTHYLHNVVGDTEIRKGEGMQLDQLIQNTSHNRDSNVRIQPFDLDILKEAFQLSETTPVELSVSEKGIPTIAGKSKSEAKDKDRKHKKHKDRDKDKDKEHKKHKHRHKDKDRSKDKDKEKKKDRSGHHDSGADHSKKHHEKKRKHDGDEDLSDVHRHKKSKHKSSKIDEVGAIKVAG |
Length | 221 |
Position | Head |
Organism | Gossypium raimondii (New World cotton) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -1.465 |
Instability index | 35.06 |
Isoelectric point | 9.45 |
Molecular weight | 25324.09 |
Publications | PubMed=23257886
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02805
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.58| 15| 15| 125| 139| 1
---------------------------------------------------------------------------
125- 139 (28.15/ 8.77) DKDRKHKKHKDRDKD
141- 155 (27.89/ 8.62) DKEHKKHKHRHKDKD
178- 192 (24.54/ 6.67) HSKKHHEKKRKHDGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.22| 14| 20| 55| 69| 3
---------------------------------------------------------------------------
55- 69 (19.74/17.44) DTEIRKgEGMQLDQL
78- 91 (24.48/15.76) DSNVRI.QPFDLDIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.68| 15| 37| 162| 176| 4
---------------------------------------------------------------------------
162- 176 (27.03/11.64) KEKKKDRSGHHDS.GA
201- 216 (21.65/ 7.93) HKKSKHKSSKIDEvGA
---------------------------------------------------------------------------
|