<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02793
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSQFTRQTPAPAPPPPVEDVGYEHSISATLLSPLNELQSLSQTLFLALSPPQSKPPPLPPLAAFLECDKALASAISLAHIHQLKQRKIDALEAEILDLDAQWREICRELAAGKAELEEMIEEGDGHIKAIDDAKKASIPYPELLAYAQSLSAFTSAPPNMPDLMLPGQPPPPLFFPPFPNEEKMRRGRLNAEAPLGLLGETHSVGRPPTVSPKPDANQHVPGANPYRQDHRAPPPQFFDLDLDLNPDL |
Length | 248 |
Position | Middle |
Organism | Hypholoma sublateritium FD-334 SS-4 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Strophariaceae> Hypholoma.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.399 |
Instability index | 69.15 |
Isoelectric point | 4.91 |
Molecular weight | 27075.53 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02793
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.52| 14| 39| 2| 15| 1
---------------------------------------------------------------------------
2- 15 (28.87/10.86) SQ..FTRQTP.......APAPPP
41- 56 (21.86/ 6.43) SQtlFLALSP.......PQSKPP
151- 171 (22.79/ 7.02) SA..FTSAPPnmpdlmlPGQPPP
---------------------------------------------------------------------------
|