<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02792

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMPCRKVPRSRAAYKIGVAWDQQKRRDLTEGGDSELLGRSQILTFASSPLPALQPWCHSDRDKISSIGYIFSTLFHWLSPPTMDHYTPTGTFVYQYQQLEPGILNDTYSTSPYSTPPDYSPTSAESSDSPSPLVLHAPIPVSNVAMPIVDYFSGTDDAGPVGRGACLYEMNKEAPIFVHDLAVSPATAFERESDLSVPMLQYPTDDTLEHYFPEAAELANVFSSLQLVNNSGSPNFEHGDQAPHVSPAISSEYSGFCQTLEPLQTTFPTPSELLAELTEKGLSVPSDEISSDARSESASKARRRAMAKRVGFVPTDPDTISSHDKKRHYLESLEQYIVYLHEQFSLLQQEHPPLQQVAQYKGLSSRSIRTILVHMENTTRDLNVRTVAEEERFIRLRDEILRRESGNWLALCKLMIQTTPVHVEGHDETASSLSNSVLVLYRSYPGDPGLQDYLKAAIQDGILPVSTFVSTLLQAARSPELHIPATLDTLCRIALDFHYSSGQPPFGSVVPSSASATIILGTVQDALALLRTAHSLPISHFHQLITSASELVILLLSCVPDISQVPTTQALLHFSDVSELLNYSLTPDVRQVLDNFVMSLTLLIRDDVKAAREAQMMHTIQLTLGKGDILGPSSDTDIITLGLLLNYMIAFADAIFWIATERLPTGHTNMERVMSSMQWRSLSRVSAGHPGRQPSVTRSYYYPRSHVWHSTEVMRGYGRPSSLDDLLVSFTEVIKTTDTSQNADLSGALKEGLTALFRRPDVIVEGEHAIPRDVGHESTPDEDATRSLSREFLQQLIKHSLVSPQIAAQLDPQVNNETPPKWHAEANDLGLDLTTFLESKLIQDSNLGETNLWMDRIWRDCGSHILFANIVHKRFASAVASLEVEALGQLCKILHRYDNALDMVALHKSITDLLFYSIQFLEDYDCETVIPKQRLDTSAMLSCLCNIPSLDSRFFENREITRNGRTVSSAFFLNTDTVAHPRSERSQAEVTSFNAWFKALFDSSSEGIEDNILRSTNPKVLLRIAPFLFSQAIAFTVAQKMEKEVLVNGISYFTGPLLNWTLVSVIKFMIKEILQPRPFLVHTTMYYDIIQSLLLSPSCPKSVLALCSPQITVLLTDKKRPAPAAPVPNSFKVSAVRHAVANATGLKLNSDALATDLGGQIWYEQDQQAVQTAFSMARSHNPPFLDIRRCLKTLPPIKFLQLFWNELIAAASLGELEACRRIATFVLTMPQDATMPPILPIFLFVSLPSIIANADKQEPSEQMMTIELLVAVVSSVLNAAIHLEWAMRFASSNDRLVLGQSSVALARRLALDLRRDRTSSVSTIILQRLTSSTSFVANFPAFVGELGA
Length1347
PositionTail
OrganismHypholoma sublateritium FD-334 SS-4
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Agaricomycetidae> Agaricales> Strophariaceae> Hypholoma.
Aromaticity0.08
Grand average of hydropathy-0.090
Instability index57.33
Isoelectric point5.58
Molecular weight149525.55
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02792
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.54|      28|      33|     509|     540|       3
---------------------------------------------------------------------------
  509-  540 (32.71/31.51)	VpSSASATII..LGTVQDaLALLRTAHSLpiSHF
  544-  573 (43.83/23.82)	I.TSASELVIllLSCVPD.ISQVPTTQAL..LHF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     110.47|      34|      46|     341|     375|       4
---------------------------------------------------------------------------
  341-  375 (52.96/44.39)	EQFSLLQQEHPPlQQVAQYKGLSSRSIRTILVHME
  390-  423 (57.50/43.15)	ERFIRLRDEILR.RESGNWLALCKLMIQTTPVHVE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     165.14|      53|     855|     429|     489|       5
---------------------------------------------------------------------------
  125-  186 (82.26/46.65)	SSDSPSPLVLHAPIPvsnvAMP.IVDYFSGT..DDAGPVGRGACLYEMNKEAPifvhDLAVsPAT
  430-  485 (82.88/63.72)	SSLSNSVLVLYRSYP....GDPgLQDYLKAAiqDGILPVSTFVSTLLQAARSP....ELHI.PAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.43|      11|      39|    1192|    1202|       6
---------------------------------------------------------------------------
 1192- 1202 (21.52/13.42)	TLPPIKFLQLF
 1233- 1243 (22.90/14.85)	TMPPILPIFLF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.99|      23|      50|    1018|    1040|       7
---------------------------------------------------------------------------
 1018- 1040 (37.33/21.63)	KVLLRIAPFLFSQAIAFTVAQKM
 1070- 1092 (40.66/24.20)	KEILQPRPFLVHTTMYYDIIQSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.06|      30|     548|     244|     281|       8
---------------------------------------------------------------------------
  244-  281 (41.48/35.93)	VSPAISSEysgfcqtLEPlQTTFPTPSELLAELTEKGL
  801-  830 (55.58/27.34)	VSPQIAAQ.......LDP.QVNNETPPKWHAEANDLGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.52|      18|     461|     303|     332|       9
---------------------------------------------------------------------------
  283-  300 (29.41/24.27)	VPS..DEISS.DARSESASKA
  312-  332 (22.11/16.24)	VPTdpDTISShDKKRHYLESL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02792 with Med5 domain of Kingdom Fungi
Unable to open file!