<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02775
| Description |
Uncharacterized protein (Fragment) |
| Sequence | LLISAALVKAAKQFDALVAALPPSEGGEKAQLRRIAELQAENDAVGQELQKQLEAAVKELKQVQELFSQAADNCLNLKKPD |
| Length | 81 |
| Position | Middle |
| Organism | Gossypium raimondii (New World cotton) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Malvales> Malvaceae> Malvoideae> Gossypium.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.223 |
| Instability index | 48.29 |
| Isoelectric point | 5.10 |
| Molecular weight | 8724.91 |
| Publications | PubMed=23257886
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02775
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.38| 19| 27| 31| 51| 1
---------------------------------------------------------------------------
31- 51 (25.54/19.02) QLRRIAEL..QAENDAVgqELQK
59- 79 (26.84/13.67) ELKQVQELfsQAADNCL..NLKK
---------------------------------------------------------------------------
|