<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02741
Description |
Uncharacterized protein (Fragment) |
Sequence | SDESDPEVQQLRARAEELRLRLEDRNALIKAAIDRLRQLLDALCMWDSSRRELQATAG |
Length | 58 |
Position | Head |
Organism | Monoraphidium neglectum |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Chlorophyceae>
CS clade> Sphaeropleales> Selenastraceae> Monoraphidium.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.702 |
Instability index | 74.15 |
Isoelectric point | 4.99 |
Molecular weight | 6693.46 |
Publications | PubMed=24373495
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02741
No repeats found
No repeats found
|