<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02741
| Description |
Uncharacterized protein (Fragment) |
| Sequence | SDESDPEVQQLRARAEELRLRLEDRNALIKAAIDRLRQLLDALCMWDSSRRELQATAG |
| Length | 58 |
| Position | Head |
| Organism | Monoraphidium neglectum |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> core chlorophytes> Chlorophyceae>
CS clade> Sphaeropleales> Selenastraceae> Monoraphidium.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.702 |
| Instability index | 74.15 |
| Isoelectric point | 4.99 |
| Molecular weight | 6693.46 |
| Publications | PubMed=24373495
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02741
No repeats found
No repeats found
|