<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02738
| Description |
Uncharacterized protein |
| Sequence | MSNDILTQLQTCYDQLLTQFFATLSYLSQRHPLVAPDPDPNDPFTNPPAGMATARASSRFQALNPPNDTTSAMTAIPTVNPGPEDTDRAPFPLHPVPPATFANAQRELAEDLVLKGQQIEMLISRLPGIGKGTQEQAEDIKVLADKVQKMEQERHARRREMKEYADRLERVIMAMAVNVDYGDDDTGNGNGLNGHG |
| Length | 196 |
| Position | Middle |
| Organism | Fonsecaea multimorphosa CBS 102226 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Fonsecaea.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.605 |
| Instability index | 39.24 |
| Isoelectric point | 4.86 |
| Molecular weight | 21567.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02738
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.86| 16| 16| 53| 68| 1
---------------------------------------------------------------------------
48- 65 (22.39/10.22) PAGmaTARASSRFQALNP
66- 81 (28.87/15.04) PND..TTSAMTAIPTVNP
83- 97 (29.61/15.59) PED..TDRAPFPLHPV.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.26| 11| 19| 139| 149| 4
---------------------------------------------------------------------------
139- 149 (16.79/12.15) DIKVLADKVQK
160- 170 (18.46/13.96) EMKEYADRLER
---------------------------------------------------------------------------
|