<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02733
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MAELTTDQVRSLDQTRQRLLALHKSLVALGSELVTQNPLPSWPALQLHANLVSNNLQTIVSQLAEHRDTYQSTVAFPTPKFPGTQRAFILETLLRTKLEPNVEDWVEEGENINAQKHKATFRGLSDDDRNALWQWAPGAANGAARKQKWGADFTLEEKQKGVENVATGLRRHLVEPPDDEGEEGPEEEEDEYEISDEEDEGEDMDKMDIEKQPPKTEASSASTETRSALPTAGQMDLGALHKFMTTGR |
| Length | 248 |
| Position | Head |
| Organism | Fonsecaea multimorphosa CBS 102226 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Fonsecaea.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.813 |
| Instability index | 53.17 |
| Isoelectric point | 4.67 |
| Molecular weight | 27700.26 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02733
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.35| 10| 17| 174| 183| 1
---------------------------------------------------------------------------
174- 183 (18.85/ 9.77) VEPPDDEGEE
194- 203 (17.50/ 8.61) ISDEEDEGED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.70| 18| 29| 104| 121| 3
---------------------------------------------------------------------------
104- 121 (33.31/23.07) DWVEEGENINAQKHK..ATF
134- 153 (28.39/18.64) QWAPGAANGAARKQKwgADF
---------------------------------------------------------------------------
|