Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MALTGVFILPIAPGQSSPSSALISHISRSFPAEPLPSFHLDYRLFVDTSSLLPGSDTSQRKSASILTLSHTPFKTYVATSPPKDKSQPTDQPTTFTVVTVPSSSADPFTQLIGTKFQPQWAHRQSMIVDSGTALSLENGQWVIRIGDLKTPSRQTQTGSNLRGMVVEVSFIEQPQLDATRSASQGLLDDAAALKDVTAKGVSKEDETLLRGFLDSVTDGSGVPSIYSVENARSLIRRTKLYGKDKDTSDASPDWDLANLYLDVLRGPRG |
Length | 269 |
Position | Head |
Organism | Fonsecaea multimorphosa CBS 102226 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Fonsecaea. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.295 |
Instability index | 47.09 |
Isoelectric point | 6.09 |
Molecular weight | 29066.30 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02732 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 39.73| 11| 19| 113| 123| 1 --------------------------------------------------------------------------- 113- 123 (23.59/18.42) GTKF...QPQWAHR 131- 144 (16.14/10.42) GTALsleNGQWVIR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.72| 17| 19| 75| 91| 2 --------------------------------------------------------------------------- 75- 91 (30.05/16.65) TYVATSPPKDKSQPTDQ 94- 110 (28.67/15.57) TFTVVTVPSSSADPFTQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ASPDWDLANLYLDVLRGPRG 2) LIRRTKLYGKDK | 250 234 | 269 245 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab