| Description | Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MALTGVFILPIAPGQSSPSSALISHISRSFPAEPLPSFHLDYRLFVDTSSLLPGSDTSQRKSASILTLSHTPFKTYVATSPPKDKSQPTDQPTTFTVVTVPSSSADPFTQLIGTKFQPQWAHRQSMIVDSGTALSLENGQWVIRIGDLKTPSRQTQTGSNLRGMVVEVSFIEQPQLDATRSASQGLLDDAAALKDVTAKGVSKEDETLLRGFLDSVTDGSGVPSIYSVENARSLIRRTKLYGKDKDTSDASPDWDLANLYLDVLRGPRG |
| Length | 269 |
| Position | Head |
| Organism | Fonsecaea multimorphosa CBS 102226 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Fonsecaea. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.295 |
| Instability index | 47.09 |
| Isoelectric point | 6.09 |
| Molecular weight | 29066.30 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP02732
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.73| 11| 19| 113| 123| 1
---------------------------------------------------------------------------
113- 123 (23.59/18.42) GTKF...QPQWAHR
131- 144 (16.14/10.42) GTALsleNGQWVIR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.72| 17| 19| 75| 91| 2
---------------------------------------------------------------------------
75- 91 (30.05/16.65) TYVATSPPKDKSQPTDQ
94- 110 (28.67/15.57) TFTVVTVPSSSADPFTQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) ASPDWDLANLYLDVLRGPRG 2) LIRRTKLYGKDK | 250 234 | 269 245 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab