<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02731
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHEFALYGQVRKDDHHRMLQQLAGFARMQPQDAKEIHLVFKARQPAGVDLVQSIGASHLASQQQQDMQRVKNMLNAGLYYVQLVGEVLPPEKQAGGVAEAGGDVTMANGNGGQGGEKQSVTWTFEFKDTPDAGKQAVSSRLISRTPMEDGNFVQFLDHFGYDYVSRYMVVGSRFYDHDTTLFLHKVLRLPQVAADEAISDKSFLPNLDDLPELDGSGGYILQASIDVVDGNNPELKERATRQLLAIKEALRQAVDLSPGDRLALDTRLPVSSRRT |
Length | 275 |
Position | Head |
Organism | Fonsecaea multimorphosa CBS 102226 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Fonsecaea.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.424 |
Instability index | 43.03 |
Isoelectric point | 5.61 |
Molecular weight | 30424.90 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP02731
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 151.01| 53| 120| 88| 146| 1
---------------------------------------------------------------------------
88- 146 (84.69/60.02) LP.....PE.KQAGG.VAEAGGDVtmANGNGGQGGEKQsvtwTFEFKDTPDAGKQAV....SSRLI..SRTP
204- 269 (66.31/34.75) LPnlddlPElDGSGGyILQASIDV..VDGNNPELKERA....TRQLLAIKEALRQAVdlspGDRLAldTRLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.03| 10| 29| 46| 55| 3
---------------------------------------------------------------------------
46- 55 (17.51/10.81) AGVDLVQSIG
76- 85 (18.52/11.79) AGLYYVQLVG
---------------------------------------------------------------------------
|