<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02724

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMNGERPAANGEQIANGFQQTVADSMPESGQLKQGLLPPNAPPPPIDHTRSYANGDLEPNQQPPDNRGNDVAHLQEQAPAEILQLISQDSYLPMAALINRASQSCWNGLSDLVTQLASVPVPELPPEQARLLPNGLPNNQSKANLDKKDRLLKFSNDQKADFIKLLVLLQWSKNVEEVSKTISINYWLMKRREAYWNVIGSMALLKQESSGFQIPNPDLKTAAEVLSRGSVLNFPRLGYVPQKNLSSRQILRILQSLNRALSVKLALSDDLPPQLRRFRIHDGRATFIVPNEFELDVSILGDSEDAPFRMVDFRFSFQPSAHIPDSLHAEIELYANSNIDRDGLKGCYDFLHELALSYKLAELHKQALDLARNQWAGNLRVELIRRNLIVQYWPERQFGKSWVEVGIASGREKQKITKMDSPPFLDIKWMRQGKRVDSLQLRLNDALLSFDAILRQVIAQHITEILDNIYDKLILTPLFANAELFMEQSLSYEDPEECSLMMQLSRSSDLQVKIDAVTGLLVLSPVTERRERLQYEVNRVQGVADDVVSKLLNYRCSVMETRVLVGILGTSWEGLRSFKFSQAEARALFGGPVSRMNMFRQNQWTLDFTLAITHASDGDHWWLLQQVSAGATNPQTRYRVLRKQRIEVKEELSSAYFDRLAEYLMGLIFLERNADFFRERKEKFDLRPLPTFGRDYELPEISFDLDMARPAFSKQPVQPIASGSVTASQMTGGPPKSRTLQKGIKVRFGGVDRLTNKVRAVAQYQYRASSAVLRRLEVSVLDASVSLNPEDKTVIIRVSTAIAEAAIPEIVDKAMDLEKVVSTVEQIHRLPGLTLKTISNSSFTVSYHEGAPAELELRIGFPSGNQAPQLDFLPPGKNPHQHLAAQYTKLIAASRGPFAARIRDFLTSLTLTLPLLNYLQKLQEKHGLDSETQQQPDLQEQEDHLRVHVLVRNATAFAIQYFTPAGQAPKDVKADSQPHMLARLEILHHINVSRKPMWLVRAALEEFQSYSRPSYSTPELGAKLKQEIFTQSDGQSKWLALDKAAACMVDQPEPLLKAMHDLLWEWAKLAKASEGKVSNNQASNKAKAAPGNPNANNAQVPNGPNNRVSAPMKAPPGKIQAPGSAIPNGANVKVQRPQANVPGGRAMPPNHKVNANSAQKQEVIMLD
Length1166
PositionTail
OrganismFonsecaea multimorphosa CBS 102226
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Fonsecaea.
Aromaticity0.07
Grand average of hydropathy-0.387
Instability index49.97
Isoelectric point8.72
Molecular weight130586.52
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02724
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.03|      11|      18|      33|      43|       1
---------------------------------------------------------------------------
   33-   43 (23.74/11.73)	QGLLPPNAPPP
   53-   63 (23.29/11.37)	NGDLEPNQQPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.38|      14|      15|     141|     154|       2
---------------------------------------------------------------------------
  141-  154 (23.15/15.24)	KANLDKKDRLLKFS
  158-  171 (24.23/16.29)	KADFIKLLVLLQWS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.11|      25|      25|      84|     108|       3
---------------------------------------------------------------------------
   84-  108 (44.60/30.79)	LISQDSYLPMAALINRASQSCWNGL
  111-  135 (42.51/28.93)	LVTQLASVPVPELPPEQARLLPNGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     147.30|      40|     240|     837|     876|       4
---------------------------------------------------------------------------
  277-  312 (23.41/ 7.90)	.......FRI..HDGratfiVPNEFELDVSiLGDSED......APfrMVDF.....
  837-  876 (73.80/39.80)	ISN..SSFTVSYHEG.....APAELELRIG.FPSGNQ......AP..QLDFLPPGK
 1076- 1117 (50.09/24.79)	VSNnqASNKAKAAPG.....NPNANNAQV...PNG..pnnrvsAP..MK..APPGK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.97|      17|      17|     678|     694|       5
---------------------------------------------------------------------------
  678-  694 (31.77/16.40)	ERKE.KFDL.RPLPTFGRD
  696-  714 (22.19/ 9.48)	ELPEiSFDLdMARPAFSKQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.81|      16|      21|     503|     518|       6
---------------------------------------------------------------------------
  503-  518 (26.36/15.72)	LS....RSSDLQVKIDAVTG
  522-  541 (22.44/12.36)	LSpvteRRERLQYEVNRVQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.81|      16|      21|     550|     565|      10
---------------------------------------------------------------------------
  550-  565 (28.51/19.07)	LLNYRCSVMETRVLVG
  574-  589 (27.30/17.96)	LRSFKFSQAEARALFG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.36|      16|      21|    1122|    1137|      11
---------------------------------------------------------------------------
 1122- 1137 (28.09/18.22)	GSAIPNGANVKVQRPQ
 1143- 1158 (29.26/19.32)	GRAMPPNHKVNANSAQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02724 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MNGERPAANGEQIANGFQQTVADSMPESGQLKQGLLPPNAPPPPIDHTRSYANGDLEPNQQPPDNRGNDVAHLQEQAP
2) SEGKVSNNQASNKAKAAPGNPNANNAQVPNGPNNRVSAPMKAPPGKIQAPGSAIPNGANVKVQRPQANVPGGRAMPPNHKVNANSAQKQEVIMLD
1
1072
78
1166










Molecular Recognition Features






MoRF SequenceStartStop




NANANA