Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MEPLVLAPLNSLESNLNSLITSLTQTNTFTNAPQIAKDLLTSDDNLTSSLRLLQRHQQNYARILNLRAEVADLQEQLKETIRRCVALRQELGQIHPSILDTSDSDEDNDRNTKVAEVDYHTLLAFAARIGKHNADAAREAEAESVRRRIEASQAKNNASTTANRVPGSTGQGAEAQDNATAETEAELDRINSTIALNRAQMGMAFPEANMLRVGQLGQLQLFRERQVQSGGGDEIVQAAVEREVERMVRETEDIADAKMEEIEEAGSSSGSGSGGARLSPEATRWSTAGTTGAKQPSSGGRLSQKRPSASTEQKPKKKVDLDLPSSDDEDED |
Length | 332 |
Position | Middle |
Organism | Rhinocladiella mackenziei CBS 650.93 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Rhinocladiella. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.725 |
Instability index | 54.55 |
Isoelectric point | 4.86 |
Molecular weight | 36092.26 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02705 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 50.61| 14| 16| 264| 277| 1 --------------------------------------------------------------------------- 264- 277 (24.80/14.99) EAGSSSGSGSGGAR 281- 294 (25.82/15.89) EATRWSTAGTTGAK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.01| 21| 22| 144| 165| 2 --------------------------------------------------------------------------- 144- 165 (29.88/17.72) SVRRRIEAsQAKNNASTTA..NRV 168- 190 (30.14/13.89) STGQGAEA.QDNATAETEAelDRI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 44.55| 15| 16| 224| 238| 3 --------------------------------------------------------------------------- 224- 238 (25.21/15.36) ERQVQS..GGGDEIVQA 241- 257 (19.34/10.22) EREVERmvRETEDIADA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 76.25| 25| 29| 3| 27| 4 --------------------------------------------------------------------------- 3- 27 (40.15/27.19) PLVLAPLNSLESNLNSLITSLT..QTN 33- 59 (36.11/23.77) PQIAKDLLTSDDNLTSSLRLLQrhQQN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GSGGARLSPEATRWSTAGTTGAKQPSSGGRLSQKRPSASTEQKPKKKVDLDLPSSDDEDED 2) SVRRRIEA | 272 144 | 332 151 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab