<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02698
Description |
Uncharacterized protein |
Sequence | MSIPGMSRPGTSLNIAQQLRKTTQLAALEDGLRGLDKKQPGNSYTAKVKIGQKYNIIGFISSGTYGRVYKAVEKNPKSDPSSPIGTSAPKELYAIKKFKPEKEGDNVQYTGLSQSAIREMSLCTELTHPNLVHLAEIILEDKCVFMVFEYCEHDLLQIIHHHTQPTRRAIPATMIKSILFQLLNGLFYLHQNWVIHRDLKPANIMVTSSGHVRIGDLGLARLFHKPLSSLYSGDKVVVTIWYRSPDLLLGARHYTPSIDLWAVGCIFAELLSLRPIFKGEETKMDSKKTVPFQRNQMGKIVEILGMPRRENWKGLVDMPEYPQLQSLIVSRGGIPGGLYPSSNSMNRGTGNNGSGLEAWYNNCLKHASYPSDKSPGQRGFQLLSELFEYDPEQRLTAEQALYHDYFRNSDEGPYKGKIWVSNNCFEGLNEVYPHRRVSTETNDIGTGSLPGTKRGGLPDDTLLPASKRR |
Length | 469 |
Position | Kinase |
Organism | Phialophora americana |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Phialophora.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.445 |
Instability index | 44.81 |
Isoelectric point | 9.16 |
Molecular weight | 52580.56 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02698
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.08| 25| 199| 159| 188| 2
---------------------------------------------------------------------------
159- 188 (33.79/38.48) IHHHTQPTRRAiPATmiKSilFQLLNGLF.Y
364- 389 (42.29/27.08) LKHASYPSDKS.PGQ..RG..FQLLSELFeY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.47| 15| 15| 313| 327| 3
---------------------------------------------------------------------------
313- 327 (27.13/16.83) KGLVDMPEYPQLQSL
331- 345 (28.34/17.92) RGGIPGGLYPSSNSM
---------------------------------------------------------------------------
|