<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02696

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMNGERPTANGDRIANDSGPSVPDSTPEVGLKQASLSQNPLQPSVDNTHACENGDVEPSQRASDNRGNNASLQSEEAPSEILQLISQDSYLPMAALINRASQSCWNCLSDLVTQLASMPVQDLPPEQTKLLPNGLPNNQSKANLDKKDRILKFSNDQKADFIKLLVLLQWSKNVEEVSKTISINYWLMKRREAYWNAIGSMALLKQESSGFQIPNPDLKTAAEVLSRGRVLNLPRLNYIPQKDLSSRQILRVLRSLDRALSVKLALSDDLPPQLRRFRIHDGRATFIVPNEFELDVSILGEREDSPFRMVDFRFSFQPHPHISDSLHSEIELYANANIDRDGLKGCYDFLHELALSYKLAELHKQALDLARNQWAGNLRVELIRRNLIVQYWPERQLGKSWIEIGIASGREKQKMTKVESSPFLEIKWMRQGKRIDALQLHLNDALLCFEDVLRQVIAQHTTQILDNIYDKLILTPLFANSELFLEQSLSFEQPENCLLTLELSHSSDLQLKIDPVTGLLVLSPVTERTERLQYEANRVQGVTDDVVSKLLNYRCSIMETNVLVGILGTCWEVLRSFKLSQTEARALFGGPVSRMNMLRQSLWTLDYTLAITHAPDGDHWWLLQQASPGTTNPQTRYRVLRKQRLEVKEELSSAYFDRLAEYLMGLIFLERNADFFRERKEKFDLRPLPTFGRHYELPQISFDLDMARPSFSKQSIPLAASSNTLLQVAKNPPNSPASQKGIKVCFGGVDRSTNKVRAVAQYHHQASSSVLRRLEKSVLDAGVSLNPDDKTVVLRVTTSIAEAAIPKIVDKAMDVEKVVSTVEQIHRLPGLRLKTISNSSFTIAYHKEASAELELRIGFPSGNQEPQLEFFPSEQNPHQFLAAQYTKLIAASRGPFATRIRDFLTSLTLTLPLLTYLQKLQQKHGLNLDAQQQKGPPEQEDHLRVHILVRSATAFAIQYFAPAGQAPKDVKADSQPHMLARLEILHHINVSRKPMWLVRAALEEFQSYSRPSYSTPELGAKLKQEIFTRSDGQSKWLALDKAAACMADQPEPLLQAMHDHLWEWAKMAKASESNVSNTQPFTKTKAGPGHPNANNANMPNGTNSRPSAAMKGPAGKMQAPGSAIPNGANVKVQRPPGTIPGGRPMPPNHKATANAAQKQEVIMLD
Length1164
PositionTail
OrganismFonsecaea pedrosoi CBS 271.37
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Fonsecaea.
Aromaticity0.07
Grand average of hydropathy-0.417
Instability index53.76
Isoelectric point8.67
Molecular weight130630.48
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02696
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.14|      22|      23|    1078|    1100|       1
---------------------------------------------------------------------------
 1078- 1100 (40.05/30.42)	QPFTKTKaGP.GHPNANNANMPNG
 1104- 1126 (38.09/23.81)	RPSAAMK.GPaGKMQAPGSAIPNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      80.62|      37|      79|     122|     161|       2
---------------------------------------------------------------------------
  122-  144 (31.81/12.31)	...............................................LPPEQTKL..................................................LPNG.....LPNNQSKANLD
  145-  224 (14.93/ 9.49)	KKDRILkfsNDQKADFI......................................kllvllqwsknveevsktisinywlmkrreaywnaigsmallkqessgfqIPN.......PDLKTAAEVL
  225-  294 (33.89/14.37)	SRGRVL...NLPRLNYIpqkdlssrqilrvlrsldralsvklalsddLPPQLRRF.................................................rIHDGratfiVPN...EFELD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     152.48|      49|     145|     302|     397|       3
---------------------------------------------------------------------------
  347-  395 (87.52/104.19)	DFLHELALSYKLAEL.....HKQALDLARNQWAG......NLRVELIRRN...LIVQYW.PERQ
  901-  964 (64.97/16.50)	DFLTSLTLTLPLLTYlqklqQKHGLNLDAQQQKGppeqedHLRVHILVRSataFAIQYFaPAGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.30|      15|      17|     682|     697|       5
---------------------------------------------------------------------------
  682-  697 (25.43/22.90)	FDL.RPLPTFGRHyELP
  701-  716 (23.87/14.58)	FDLdMARPSFSKQ.SIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.64|      16|      21|     549|     564|       6
---------------------------------------------------------------------------
  549-  564 (27.75/18.96)	LLNYRCSIMETNVLVG
  573-  588 (25.89/17.19)	LRSFKLSQTEARALFG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.75|      14|      21|     769|     782|      11
---------------------------------------------------------------------------
  769-  782 (21.28/16.13)	VLRRLEKSVLDAGV
  791-  804 (20.47/15.21)	VVLRVTTSIAEAAI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.18|      12|      25|    1030|    1041|      12
---------------------------------------------------------------------------
 1030- 1041 (21.27/13.32)	DGQSKWLALDKA
 1058- 1069 (23.91/15.94)	DHLWEWAKMAKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.78|      18|      21|      41|      58|      14
---------------------------------------------------------------------------
   41-   58 (33.48/21.69)	QPSVDN..THACENGDVEPS
   59-   78 (25.31/14.56)	QRASDNrgNNASLQSEEAPS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02696 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AKMAKASESNVSNTQPFTKTKAGPGHPNANNANMPNGTNSRPSAAMKGPAGKMQAPGSAIPNGANVKVQRPPGTIPGGRPMPPNHKATANAAQKQEVIMLD
2) MNGERPTANGDRIANDSGPSVPDSTPEVGLKQASLSQNPLQPSVDNTHACENGDVEPSQRASDNRGNNASLQSEEAPS
1064
1
1164
78










Molecular Recognition Features






MoRF SequenceStartStop




NANANA