<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02687
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAEQEQPQQLPEAPFPAPPPFWRHFTIANEEQLKKIETSDAPQEKLPLHLAYLRPPRPPPDSAEFYTAFGQKQVIDPTKPSSLPTEQLLFNPDNPNLNHAVLLSTLTKSLLLNFLELTSVLSLDPTKHEEKMEDIRQLVLNIHVVINMYRPHQARESVKEMLEGILEDGQREIKECIRLKQKAEDFLGDVKRLRTTTALNGAIHENGTSGPQTSQMRKMEEQQRRWKMIHDMTDS |
| Length | 235 |
| Position | Middle |
| Organism | Rhinocladiella mackenziei CBS 650.93 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae>
Rhinocladiella.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.710 |
| Instability index | 66.73 |
| Isoelectric point | 5.79 |
| Molecular weight | 27042.56 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02687
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 103.21| 27| 38| 2| 36| 1
---------------------------------------------------------------------------
2- 28 (54.99/34.73) AEQEQ.PQQLPEAPFPAPPPFWRHFTIA
41- 68 (48.22/18.21) APQEKlPLHLAYLRPPRPPPDSAEFYTA
---------------------------------------------------------------------------
|