<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02685

Description "Rhinocladiella mackenziei CBS 650.93 unplaced genomic scaffold supercont1.6, whole genome shotgun sequence"
SequenceMTSNVPAEPRPPSLRHPPDSLRPSLNRSMSNVLSPIDRKPPPLQTHVGESGEDRPAKRRKVEGDTSANQASGSNTGPRTSTTPNAPQVNKTPHLRLVKPSALFRRLPKPPDKNEEGKWSQDEAPDLPARPWRLLQHSKSTDDSKPTHRSRVNLPVPNTPDSLEVPTSAPQFVSKKPAGFFPWTGKHPEDILSDINVKQGYFDKPPNPTEKELNTARVPLYNALKHKSGVDNLSILFSLVLDQKNRHGLISSVSTFKPPPRVTLTEAKRKSWISDLANADVPLRRLSRTIPQGIRGQILLDQCLQSSVPLSRAIWFAKCVCANEIRTLKRKGTTPAVAVGTESKWLREWTDNVEQFVETYLGQSNNPEWRSNIQYALRLTTRLYLENLLDRDHYLDWIVRSLTSADPDQTPFWLMVIHIYKQDLSHYRRRGRKLAEALIGKYQLLAKSTDQMMAPLRLRLHQAIRSLLLYRPVTFLMPDRWPDIVPVVQSCLDTSSPQEHQILDRLNHINGRTMGFNKQEFSAKRAPDQAIVDILDAARVPFNLEVLTDSLASAYPDIPRLIFSCLEWACTRFRQSRTRIYLFTRLIKRWQRYGHDVDTVILNYLSACREKRTTVDIDCLKHLAAHLSRSNCFPLSKYLQWLMVRGLPKRGSVGIDLDSLTGTGRVNQHQGNSDPSQLLLDLSLQNVEDHVLNLRNSLLRRSGLDPQVEESLFRRCVQYLEEKLAKSRSSSRSQEQTSPEPHFVSLPWTVRSKISMWLRSRVAEAAALSMSGTLTTPAPLGSNLFSVEQFSFIRHILECLEDEAVLADVVGILCGAQDDDLAAALVSTIHFHADTFSAMGALDVLQKRVCQTYLSWRSTKPTMPLLTTTLLDLCTSFPVKAPTIKLLQQDLVRGDRGRAVAACSPYSDGIAESLQQAGATFVEDFEAILQSEPNMNEQTMNGLFTVLAERIEKQQHFGDDSQTILSFCQLLSRLRLCRKTQADLLIQQWVSRLSPFLDGDFGASLFQALIGTGCMTCAGLFEAVRTSKSGLRQCKAITSMLRHILALDRESKTDPVLYQVRTKWLEHSRREPRIALEVLCEAGLATQLEPFGRRLLSFLVNDSTLSSSSMSDRAEEWSMKALDRLLHCEGGIRGDNLRPLLGSINIFSHRYVQLRFWLASRLGVEKASAEDQDQLVEVLGETLEQMIHETGRGHRGDGRFSQLLQAVGYEVANRLRHKVENEFLEALPKFPPSKVTSPLTAVFPSDVHQLSSIVERAFWVCSSSTTPLPGLLSHLIDKLSQHVKSLGNPPPAATSTPTCTAIPGLSTPATNMFPAQMMSVTSSPIVNTSENVSGPFHGVMLDYLQYMLQMVCLQRPGLISVGGDGPSLKKVQSEQVQLLVRLAMIATHPAIASASNSSTSKEEQQKAKRAIDFTLDVIATIVDEVSEEVRMMSAKMLKDKMQDVRLKYLFGSVNMMGSVQVHDMGEGLQMVKEGKGVVGDWKPRVWEVLDNGSGKENETSLGLGLFGARRG
Length1510
PositionKinase
OrganismRhinocladiella mackenziei CBS 650.93
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Rhinocladiella.
Aromaticity0.06
Grand average of hydropathy-0.328
Instability index53.20
Isoelectric point9.00
Molecular weight168955.58
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02685
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     202.74|      78|      97|     271|     362|       1
---------------------------------------------------------------------------
  271-  315 (49.20/32.98)	....................................................WISDLanaDVPLRRLSRTIPQGI..RGQIL..LDQCLQSSVPLSRAIWF
  316-  413 (115.91/98.21)	AKCVCANEIRTLKRKGTTPAVAVGTESKWLREWTDNveqfvetylgqsnnpeWRSNI...QYALRLTTRLYLENLldRDHYLdwIVRSLTSADPDQTPFWL
  415-  450 (37.63/15.50)	VIHIYKQDLSHYRRRGRKLAEALIGKYQLLAKSTDQ.................................................................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.65|      20|      36|     556|     591|       2
---------------------------------------------------------------------------
  556-  579 (27.70/49.15)	DIPRLIFSCLEwACtrfRQSRTRI
  595-  614 (34.94/13.28)	DVDTVILNYLS.AC...REKRTTV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.33|      30|      35|    1265|    1294|       3
---------------------------------------------------------------------------
 1265- 1294 (52.10/38.69)	TPLPGLLSHLIDKLSQHVKSLGNPPPAATS
 1299- 1328 (52.23/38.81)	TAIPGLSTPATNMFPAQMMSVTSSPIVNTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.83|      23|      35|     718|     740|       4
---------------------------------------------------------------------------
  718-  740 (38.56/23.94)	YLEEKLAKSRSSSRSQEQTSPEP
  756-  778 (39.27/24.52)	WLRSRVAEAAALSMSGTLTTPAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.00|      19|      36|     909|     928|       5
---------------------------------------------------------------------------
  909-  928 (25.69/20.76)	IAESLQQAgATFVEDFEAIL
  946-  964 (32.31/20.75)	LAERIEKQ.QHFGDDSQTIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     124.86|      33|      36|    1354|    1386|       6
---------------------------------------------------------------------------
 1333- 1363 (51.39/34.09)	GP.FHGVMLDYLQYMLQMVCL.QRPGLISVGGD
 1364- 1396 (50.42/33.30)	GPSLKKVQSEQVQLLVRLAMIATHPAIASASNS
 1397- 1419 (23.04/11.06)	STSKEEQQKAKRAIDFTLDVIAT..........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.31|      20|      34|    1203|    1222|       8
---------------------------------------------------------------------------
 1203- 1222 (33.89/25.12)	LQAVGYEVANRLRHKVENEF
 1238- 1257 (33.42/24.65)	LTAVFPSDVHQLSSIVERAF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02685 with Med12 domain of Kingdom Fungi
Unable to open file!