<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02681
| Description |
Uncharacterized protein |
| Sequence | MSSDILTQLQTCYDQLLTQFFSTISYLSQRHPLVAPIPDPNDPYTNPPSATAPPQTPNLDGTPAAPSSGLLPGPEDTDRSVYPLRPAAPEVFASAQRELSDDLVTKAQQIEYLISRLPGIGRGEEQQAEEIRILVEKVREMEARRKEKRREMRECVRRLDAVVLGMAESVEYDADSNKHEQATET |
| Length | 185 |
| Position | Middle |
| Organism | Exophiala xenobiotica |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.654 |
| Instability index | 66.14 |
| Isoelectric point | 4.75 |
| Molecular weight | 20663.89 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02681
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.26| 17| 20| 48| 66| 1
---------------------------------------------------------------------------
48- 64 (32.73/11.15) PSATAPPQTPNLDGT.....PA
66- 87 (23.53/10.98) PSSGLLPGPEDTDRSvyplrPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.14| 17| 20| 124| 143| 2
---------------------------------------------------------------------------
127- 143 (26.80/20.17) QAEEIRILVEKVREMEA
145- 161 (29.34/13.95) RKEKRREMRECVRRLDA
---------------------------------------------------------------------------
|