<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02679

Description Uncharacterized protein
SequenceMTSIPLAEPRPPPQLPRPPGLSRPPVRRSVSNVFSSPDRRPSGLQRQMSDIGDDRPAKRRKMEIEGQQLDQASSHNNLPAGVQQSADAEAEIQNIQLRWVKPSAIRRRTGKSLVKNDDDGEREEDVPELPPRPWRTTELSNAVEESKPTHRSRVNIPVPNTPDSIELPSAVPHFVPRKPAGFFPWTGKHAEDILSDTNVKTGYFDKPPNPTEKELNTARVPLYNAFKHKSGVDSLSVLFSLVLDQKSLHGTTSSVSTFKPPPRVTLTEAKRKSWIADLANADVPLRRLSRTIPQGIRGQALLDQCLQSDVPLSRAIWFAKCVCANEIRTLKRKGTAPTVAVGTESKWLREWTISVEQFLEARLAQSSLPDWRSNIQYALRLTARFYLENLLDRDHYLDWILSSLASADVGHTPFWLMITHIYKQDLSQYRRRGSRFVEALINKFQSLANVQEPAIAPVRQRLRAAIRELLFARSALFLMPDRWPQNMEVIRACLDQTLPAERQLFDGLNRINERVMGYNKAEISSIRTPDQALVEILDAARVPYNLTDLEDTLRSACSDFALLMQTCLEWSCTRFRYSRTRIYLITRLVKRWQREGLDVDTAILNFLSAYKERRTTADPQSLKHLIAQFSRSDGFTISKYMQWLMVRGLPKDGTVRIDTNSIFGSAEGTWQEEEPEAAHFLLDLSLNKVESHVVNLRRTILERAGFDPSSEEATFRECIRFVEQRLADPNSASKTKAPSVTEPSFALLPWTIRTRISMWLRARALEGAKAEQTGPALPGSRILNEEQFFLIRHVLESMDDEAVLADVVGILSTSKNDDLVASLVATIHFHADAFSSMGALELLQKQMCQVYMTWRPAKPTMPLLTSTLLDLCTAFPPKAPAVKLLQQDLVRGDRGRAVAACSPYSDGIAESLQQAGATFVEDFEAILQSETNMNEQTMNGLFSVLVDRIEKQQKFEDDPQTTLSFCQLLSRLRLCRRGQGDLLIQKWISRLLPRLDSKWGPLLLQNLLSTGCITITGLREAVATSKHGTRRNVAFASLLYQILGHTKGTVRDWAAYQTRTRWYEYVQREPKAALETLCEAGLQGFSPKFDSLLLSLLVNGSTLSSCVLSAGARQWFLKTLSRSLTCRDGELTVSDLRALFQTMNIFSHPYVQLRLRCTPENSAENASGANHDELADVLYASLQQTMQTSPSSSTKGQDRRFAQFLQTVGPEVATLIRHKVENEFLEASPKLPPGKATSPLAAVFPGETQQLPSIIERAFQVCRKDTAPSVGFMSQLIDRLSLYFKSLAYASAAPSNPNTAAQPAIPGISGPSTAMNTPQMVAAPSAPAISTSEPTSSVCSLPCLSYLKYMLQMVCLQRPALIQAGRNGPNPKQGQSEQVQLLVRLASIATHPIMVAASKQQGNKEQQALAKDVILSMFDIIATIIDEVSDEVNMMCGKLLKDKLQDGRVRYLFGSISMLGSVQVQDMGQGLQLTKEGKGIIGEWKPRMWEVLNSGSGKENETSLGLGLFGARYS
Length1514
PositionKinase
OrganismPhialophora americana
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Phialophora.
Aromaticity0.07
Grand average of hydropathy-0.306
Instability index53.52
Isoelectric point8.94
Molecular weight169019.42
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02679
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.67|      18|      27|     122|     148|       1
---------------------------------------------------------------------------
  122-  141 (25.03/16.58)	REE.DVPeLPPRPwRTTELSN
  151-  169 (27.64/18.42)	RSRvNIP.VPNTP.DSIELPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.79|      10|      17|     980|     989|       2
---------------------------------------------------------------------------
  980-  989 (19.16/11.42)	GDLLIQKWIS
 1000- 1009 (17.63/ 9.90)	GPLLLQNLLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.06|      14|      17|      27|      40|       3
---------------------------------------------------------------------------
   27-   40 (24.19/12.78)	RRSVSNVFSS.PDRR
   45-   59 (20.87/10.09)	QRQMSDIGDDrPAKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.72|      10|      27|     280|     292|       4
---------------------------------------------------------------------------
  280-  292 (13.83/13.82)	NADVPlrrLSRTI
  307-  316 (18.89/ 9.04)	QSDVP...LSRAI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.34|      16|      27|     462|     487|       5
---------------------------------------------------------------------------
  462-  477 (25.64/31.25)	LRAAIRELLFARSALF
  490-  505 (28.70/ 8.90)	IRACLDQTLPAERQLF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.20|      14|      27|     358|     371|       6
---------------------------------------------------------------------------
  358-  371 (25.52/15.78)	FLEARLAQSSLPDW
  386-  399 (26.68/16.88)	YLENLLDRDHYLDW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     134.20|      39|     423|    1041|    1084|       8
---------------------------------------------------------------------------
 1041- 1084 (64.93/56.96)	QILGHTKGTVRDWaayqtRTRWYEYVQREPKAALETLCEAGLQG
 1472- 1510 (69.27/48.16)	QLTKEGKGIIGEW.....KPRMWEVLNSGSGKENETSLGLGLFG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      84.11|      26|     282|     431|     456|       9
---------------------------------------------------------------------------
  431-  456 (44.05/25.35)	RRGSRFVEALINKFQSLA.....NVQEPAIA
  716-  746 (40.06/22.42)	RECIRFVEQRLADPNSASktkapSVTEPSFA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.13|      19|      20|    1293|    1311|      10
---------------------------------------------------------------------------
 1293- 1311 (36.43/22.75)	APSNPNTAAQPAIPGISG..P
 1314- 1334 (30.71/17.88)	AMNTPQMVAAPSAPAISTseP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.52|      13|      20|     856|     874|      11
---------------------------------------------------------------------------
  856-  868 (23.32/25.50)	PAKPTMPLLTSTL
  877-  889 (22.19/ 6.73)	PKAPAVKLLQQDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.49|      19|      20|     181|     199|      12
---------------------------------------------------------------------------
  181-  199 (35.39/18.96)	GFFPWTGKHAEDILSDTNV
  202-  220 (32.10/16.56)	GYFDKPPNPTEKELNTARV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02679 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MTSIPLAEPRPPPQLPRPPGLSRPPVRRSVSNVFSSPDRRPSGLQRQMSDIGDDRPAKRRKMEIEGQQLDQASSHNNLPAGVQQSADAEAEIQNIQLRWVK
2) RRRTGKSLVKNDDDGEREEDVPELPPRPWRTTELSNAVEESKPTHRSRVNIPVPNTPDSIELPSAV
1
106
101
171










Molecular Recognition Features






MoRF SequenceStartStop




1) KMEIE
61
65