<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02675
| Description |
"Unplaced genomic scaffold supercont1.2, whole genome shotgun sequence" |
| Sequence | MSIPGMSRSGTSLNIAQQLRKSTQLALDDSGRGHDKKIPGNNYTAKVKIGHKYTIIGFISSGTYGRVYKAVEKNPKSDSTSPSGTSPPKELYAIKKFKPEKEGDNVQYTGLSQSAIREMSLCTELSHPNVVHLAEIILEDKCVFMVFEYCEHDLLQIIHHHTQPTRRPIPATMIKSILFQLLNGLYYLHQNWVIHRDLKPANIMVTSSGHVRIGDLGLARLFHKPLSSLYSGDKVVVTIWYRSPDLLLGARHYTPSIDLWAVGCIFAELLSLRPIFKGEETKMDSKKTVPFQRNQMGKIVEILGMPRRENWKGLVDMPEYPQLQSLIVSRGGMPGGLYPNPPTSLNRGSGGNNGSGLESWYNNCIRHASYPPDKSPGQRGFQLLSELFEYDPDLRLTAEQALHHEYFRNTDDGPNKGKIWVSNNCFEGLNEVYPHRRVSTETNDIGTGSLPGTKRGGLPDDTLLPASKRR |
| Length | 470 |
| Position | Kinase |
| Organism | Fonsecaea pedrosoi CBS 271.37 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Fonsecaea.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.492 |
| Instability index | 45.29 |
| Isoelectric point | 9.18 |
| Molecular weight | 52623.46 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02675
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.70| 17| 17| 320| 336| 3
---------------------------------------------------------------------------
320- 336 (34.49/19.96) YPQ.LQSLIVSRGGMPG.G
338- 356 (25.21/12.68) YPNpPTSLNRGSGGNNGsG
---------------------------------------------------------------------------
|