<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02668
| Description |
Uncharacterized protein |
| Sequence | MFNMSRPGSGLSIAQQLRKTVQLGLDDSGRGLDKKQSGNNYTSKVKVGQKYNIIGFISSGTYGRVYKAVEKNPKSDPSSPVGATPNKELFAIKKFKPEKEGDNVQYTGLSQSAIREMSLCTELSHPNLIHLAEIILEDKCVFMVFEYCEHDLLQIIHHHTQPTRRPIPATMIKSILFQLLNGLFYLHQNWVVHRDLKPANIMVTSSGHVRIGDLGLARLFHKPLSSLYSGDKVVVTIWYRSPDLLLGARHYTPAIDMWAVGCIFAELLSLRPIFKGEETKMDSKKTVPFQRNQMGKIVEILGMPRRENWKGLVDMPEYPQLQSLIVSRGGMPGSLYPTSSTSLNRTGNNGSGLENWYNNCLRHASYPADRSPGQKGFQLLSELFEYDPDQRLTAEQALHHEYFKNTDEGPHKGQIWVSNNCFEGLNEVYPHRRVSTETNDIGTGSLPGTKRGGLPDDTLLPAAKRR |
| Length | 466 |
| Position | Kinase |
| Organism | Exophiala xenobiotica |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.473 |
| Instability index | 44.54 |
| Isoelectric point | 9.13 |
| Molecular weight | 52353.20 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02668
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.17| 25| 199| 156| 185| 2
---------------------------------------------------------------------------
156- 185 (36.40/44.71) IHHHTQPTRRPiPATmiKSilFQLLNGLF.Y
361- 386 (43.77/31.16) LRHASYPADRS.PGQ..KG..FQLLSELFeY
---------------------------------------------------------------------------
|