<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02665

Description Uncharacterized protein
SequenceMTSNPPAESRPPSLRCPPDLHRPSLDRAGSDIFPPIGRRPPGLQRQNTESGQDRPAKRRKVEGDVQPNQASTSSNGSTVTAIINATTPTDTKGPQLRLVAPAALQLEFRTLQDKKSEPLVDQEPPDFPGRPWNPSQQFKAADGSQPSHRSRVYVPVPTTPDSLDPPGSAPRFVPKRAAGFFPWTGKHPEDVLNDTNVKQGYFDKPPNPTEKELNTARVPLYNAFKHKSGVDSLSTLFSLILDKKNQQSLINPHTTFKPPPRVTLTEAKRKSWIADLANADVPLRKLSRTIPQGIRGQLLLDQCLQNVVPMSRAIWFAKCVCANEIRTLKRKGTTPALAMGAEGKWLREWTINVEQFLEAHLAQIGSIGWRSNIQYAVRITTRLYMENLLDRDHCLDWILRSFATSPLDQLPFWLMITHIFRQDMSYYRRRGKRFAETLIEKYELVRTTAGQAAVPLTQRLHHAIRGLLLTRPRNFLMPDKWPEIYPIIRTCLDGKVQQERQILDELNRINERAMGFNKRQFSAKRSPVQAIVEVLDSLHAPFDVAKLAETLTTVCLDADVVIFSCLEWACTRFQSSNARIYLFARLIRRWQRAGHDTDTVILNYLSAYREGKTMTDVQCLSHLIAQLSRSNSFPTAKYLQWLMVRGLPKKGTVRLDTTTIPDAGMSSSDSSHFLLDLSLQNAGEHVLNLRNSLLERCGFDLSSERDLYNHCIQYIGQELSQLGPSSRSETSSIAEPALAALPWSIKSRISLWLRSRVVQTAMHDVPGISSPLSMLSTLRLNCEQFSFIRYVLECMNDQAVLADVIGILCSSQDDDLVASLVATIQYHAEPFMAIGAFEVLHKRACQIYMTWRTTKPAMTLLTNALLELCTAFPVKTPTLKFLQQNFVRGDRGRAVAACSPYSDGIAESLQQAGATFVEDFEAILQSEPNMTEQTMNGLFSVLVDRIEKQQNFGDDSPTMFSFCLLLSRLRLCRKAQADQLIQQWLGKLAPFLDGDFGPVIFQNLIGAGCLNFVGFFEAINISKLALSKLPSATALLRYVTSPDKGLLGNAALYHTRTQWSNYCHQEPRRVLEVLCQLGKENVQNPSETRLVYLLANDRTLTSSALPEPAAKRLVQALDHLLSCDRGGNIDSANLRPLLDSVNIFSHRYVRLRLWLISHLGAEHTVPVDQGQLVEALTDALEQMLHEADGAQNDDSRIAQLLEAVGPEVANRLRHKVEHEFLEALPRFPPSKTTSPLSAMFPGDVHHLSSIVNRAFRVCTKDTNPMPGFAGQLIDRLSQFFKSQGNNVATPNSAAIPGLSGHSVNGSPAQMMSVTSSPHASSSDGVGGANGWAILSCLDHMLQMVCLQRLAVISAGRSGANIKQGQTEQVQLLVRLGLIFTHPTISSASKHLSNKQEQEKVKNVHDFILDVLATIVDEVGDEVKMMCGKLLKDKLHDARLKYLFGSVNTTGSLQAQDMGHGLQMFKEGKGMIGEWRPRVWEVLDNGSGKENETSLGLGLFTARRGRATED
Length1509
PositionKinase
OrganismExophiala xenobiotica
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
Aromaticity0.07
Grand average of hydropathy-0.274
Instability index49.32
Isoelectric point8.80
Molecular weight168136.52
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02665
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.05|      12|      26|      11|      22|       1
---------------------------------------------------------------------------
   11-   22 (27.05/13.83)	PPSLRCPPDLHR
   34-   45 (26.00/12.99)	PPIGRRPPGLQR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.21|      21|      26|    1084|    1108|       2
---------------------------------------------------------------------------
 1087- 1108 (31.50/29.97)	ETRLV....YLLANDR..TLTSSALpEP
 1110- 1136 (27.71/11.13)	AKRLVqaldHLLSCDRggNIDSANL.RP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.82|      17|      26|    1231|    1248|       3
---------------------------------------------------------------------------
 1231- 1248 (27.53/21.68)	KTTSPLSAmFPGD.VHHLS
 1260- 1277 (28.29/16.55)	KDTNPMPG.FAGQlIDRLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.10|      19|      26|     731|     754|       5
---------------------------------------------------------------------------
  719-  737 (29.32/12.86)	LSQLGPSSRSE.....TSSIAEPA
  738-  761 (25.78/20.96)	LAALPWSIKSRislwlRSRVVQTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      90.85|      24|      26|     261|     285|       6
---------------------------------------------------------------------------
  241-  258 (23.65/ 9.84)	...LDKKNQQSLI......NPHTTFKP
  261-  285 (34.54/22.30)	RvTLTEAKRKSWIAD..LANADVPLRK
  288-  312 (32.66/16.66)	R.TIPQGIRGQLLLDqcLQNV.VPMSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      91.68|      22|      26|     143|     164|       7
---------------------------------------------------------------------------
  125-  142 (27.20/12.24)	...P...DFPGRPWNP.SQQF..KAAD
  143-  164 (39.59/21.44)	GSQP...SHRSRVYVP.VPTTP.DSLD
  167-  193 (24.89/10.52)	GSAPrfvPKRAAGFFPwTGKHPeDVLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.69|      16|      26|    1171|    1186|       8
---------------------------------------------------------------------------
 1171- 1186 (26.29/18.41)	QLVEALTDALEQML.HE
 1199- 1215 (22.40/14.50)	QLLEAVGPEVANRLrHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.00|      16|      17|     592|     607|       9
---------------------------------------------------------------------------
  592-  607 (28.75/15.86)	RAGHD.TDTVILNYLSA
  609-  625 (24.25/12.35)	REGKTmTDVQCLSHLIA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.41|      18|      26|     928|     946|      10
---------------------------------------------------------------------------
  928-  946 (28.10/20.37)	PNMTEQ..TMNGlFSVLVDRI
  950-  969 (28.30/15.80)	QNFGDDspTMFS.FCLLLSRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.62|      12|      22|     557|     568|      11
---------------------------------------------------------------------------
  557-  568 (22.87/14.69)	DADVVIFSCL..EW
  577-  590 (17.74/ 9.66)	NARIYLFARLirRW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.56|      10|      22|      87|      96|      12
---------------------------------------------------------------------------
   87-   96 (18.57/ 9.65)	TPTDTKGPQL
  110-  119 (16.98/ 8.21)	TLQDKKSEPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     177.91|      53|     231|     782|     847|      13
---------------------------------------------------------------------------
  782-  834 (91.56/77.76)	CEQFSFIRYVLECMNDQAVLAD..VIGILCSSQDDDLVASLVATIQYHAEPFMAI
  869-  923 (86.35/48.94)	CTAFPVKTPTLKFLQQNFVRGDrgRAVAACSPYSDGIAESLQQAGATFVEDFEAI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.46|      16|      28|    1404|    1419|      14
---------------------------------------------------------------------------
 1404- 1419 (27.01/17.96)	HDFILDVLATIVDEVG
 1435- 1450 (28.46/19.33)	HDARLKYLFGSVNTTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.17|      16|      32|    1353|    1370|      15
---------------------------------------------------------------------------
 1353- 1370 (19.73/26.54)	SAGRSGANiKQGQtEQVQ
 1386- 1401 (27.44/21.59)	SASKHLSN.KQEQ.EKVK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.09|      16|      27|     356|     371|      16
---------------------------------------------------------------------------
  356-  371 (28.99/17.02)	FLEAHLAQIGSIGW..RS
  384-  401 (27.10/15.42)	YMENLLDRDHCLDWilRS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.74|      19|      27|     464|     484|      17
---------------------------------------------------------------------------
  464-  484 (30.22/25.79)	IRGLL...LTRPRNFLmpDKWPEI
  488-  509 (27.51/15.37)	IRTCLdgkVQQERQIL..DELNRI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.12|      14|      32|    1460|    1473|      19
---------------------------------------------------------------------------
 1460- 1473 (25.89/14.64)	GLQMFKEGKGMIGE
 1495- 1508 (24.23/13.27)	GLGLFTARRGRATE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02665 with Med12 domain of Kingdom Fungi
Unable to open file!