<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02659
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPSTALFYLPLAPTQTSPTSTLISHITRTLPADPLPPFILDHRLFVDTSSLLPNTDTSKRSFTSILHLSQIPHDSFIGTTGAGAGAAAPPSQPSQSTTPTTEPSLTITSLPSPATDTLTQLIGTKLQPQWAHRQSVIIDNGTSLSLHDGDYTVRIGDLKTSPRGNQPLSLRGTILEVTYNADKDEDVEEAATDGATATATARVGKEDETLLRGVVDALAESAGVSMAGARVFFRKTLRQERGKLPRGVTDWDLVRLYMTALRGSRG |
| Length | 266 |
| Position | Head |
| Organism | Exophiala oligosperma |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.267 |
| Instability index | 45.53 |
| Isoelectric point | 6.06 |
| Molecular weight | 28443.64 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02659
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 127.21| 29| 38| 11| 39| 1
---------------------------------------------------------------------------
11- 39 (52.86/25.25) LAP.TQTSPTS.TLISHITRTLPA...DPLPPFI
51- 77 (33.88/13.81) LLPnTDTSKRSfTSILHLSQ.IPH...D...SFI
91- 122 (40.47/17.78) SQP.SQSTTPT.TEPSLTITSLPSpatDTLTQLI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 108.53| 29| 31| 188| 216| 2
---------------------------------------------------------------------------
148- 175 (18.65/ 7.90) .....DG...DYTVR..IGdlktspRGNQPLsLRGTIL
188- 216 (47.24/30.74) EEAATDGATATATAR..VG......KEDETL.LRGVVD
220- 250 (42.64/27.06) ESAGVSMAGARVFFRktLR......QERGKL.PRGVTD
---------------------------------------------------------------------------
|