Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDSVALDPLSSLENHLNALVANITQTNTFANAPQLAKDLVTDDDNLSSALTLLRKHQQNYARLLNLRVEVEDLQTQLQDTIRRSVAFRDEILQIHPTILDDSDEEEEDDDDDAQNNITEIDYHTLLAFAARIGKHNAAAAREAEAEAVRRKVAAKREAVNGAADGEENATAETEAEVERINNTVAQTRAQMGMAFPDANLLRVGALGQLQLYQEKQATAGANVEDALDREVERLVRESEDIAEAVVEPVENTAAEEGMGWSSPELAKRTLPGPSGQTEQAHGSGQASMPQQVKRQGGDLPPAPPKRKVALDFPGSDDEEDDD |
Length | 322 |
Position | Middle |
Organism | Exophiala oligosperma |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.661 |
Instability index | 57.49 |
Isoelectric point | 4.39 |
Molecular weight | 35103.98 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02647 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.26| 11| 210| 99| 109| 1 --------------------------------------------------------------------------- 99- 109 (21.23/13.12) LD..DSDEEEEDD 310- 322 (17.03/ 8.98) LDfpGSDDEEDDD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.64| 22| 22| 238| 259| 2 --------------------------------------------------------------------------- 238- 259 (35.58/24.77) SEDIAEAVVE.PVENTAAEEGMG 262- 284 (34.06/23.39) SPELAKRTLPgPSGQTEQAHGSG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 96.96| 30| 31| 133| 163| 3 --------------------------------------------------------------------------- 133- 163 (45.07/36.43) GKHNAAAAREAEAEAVRRKVAAKReAVNGAA 165- 194 (51.89/37.12) GEENATAETEAEVERINNTVAQTR.AQMGMA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ELAKRTLP 2) MPQQVKRQGGDLPPAPPKRKVALDFPGSDDEEDDD | 264 288 | 271 322 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab