<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02639

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMNATLDFPGNCPTNVYTLNDFGEIAYIVCTAANPPTHDPSAFVATTENILARLRATERQFRENSILAALDVEARQLFTFYKKVDITAPKDQKALLMKFGFVLRSNSCTIAYKTAARLPDLMKPEQARLYRLFITAIVSSVKLLPVGDSGLQPVGPNLYLVETAPPTTEHDHLAEKRTWVLYRIHLQVVPNGHIVLLIAKDNRLSFLPIRHCLAGADAGAHNSDFRAVYLAPIGRIARVSRSKLSFQMNVDRDTAEEHSRETPSSNARREMWRNLLPLWLEDHMNSAVEISDVFWIEVEVPVEELGRISNGSQGDLTNAEDALGDPITWRPIFWPENLCFILDGDSLVQPSMIDVDDDPMQFVRDWILGIGSAAPKVETGRHNMKEDEEDEPLFADEGTFDDPEHFQPFGPPAFPASQTIYPTPPDVGITHPTPGLSSVDGAAMTPANPPGGSAELVQQQDEEMPDFDDVPPASGMSGYYDEDLFEEMPDDSFGPEANGDEPNWDFFDDPGVQPKQSRSMSHSRKEGSTSRGDPKHERFDAGDAKINGGKLLDPMNPGKNEISTVNGSPRMTTGTQSQMPPSPTPAPDNVLSVIEHKTLQSPPKPAPPLWNSEQGKNTTLTANSRRRSSIYDSPKALHSIPIHDSRYDAEGDYWFDPLPADSKVKMRPRPSSMFQRPPSSPSGSDSSMTSSSQSPKASDPGNVVPPLVRQWTHYDPGSQDATSHKGDFDKKTIRQEVQQMLGLLKPGLVEPPSAADFHLDERDDHQTPLITAQKSRHVAQVLVDQMSQTSLLAHGEYQADMRILPDDGVEMNVDLSGINTSASPSTLFQLTNLKADHNGARLQGRVTRIKPSQICVKRIERPLTANISILNFWDTLNLQPANGPKDVTAFCIHPRPANIRDGSLNLLQRLSDSYATCALGTHNIGHLPDVTDDGLISWNADGVGEHNLLQSTTMVGNALAAATSISGTVVVYMVSRGESPTAYLEMCIAFYNLFESFSKTRTNSLGVSDLQLQVIPQGFIANEETLVIRPQTAYLKLAIEVYNRLPPLDLAGHPSACGSAVVLSRSENTVRLQLSPTYVSPLEKNGPCLHLAYSMSLDKKWLAAVWTDELGQIALSMSYCSHVRKSGRRRPRHEIFKEMWEVSQDLMSKVRGTWRLAVVRHGYYEPAEILEWHQIVDLSPAPQKQCLLLLLSIQLQPELAVLPPPVQGKGPLVGMHNQYGTPVSTPQASMTSPDQVVPATPTPGGSSFVNASTPPDPGFDPNAESDLRVFDPSEESWGIILPYGANQSRSMTELNPSHITGFLLKRRGPRGEDGYNMIEISLVRSITQTTNKPNEITADESLEDMIKQYRGLVTLGASRGCVDPNRECLPWHIATAIRGARILEQAI
Length1386
PositionKinase
OrganismPhialophora americana
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Phialophora.
Aromaticity0.07
Grand average of hydropathy-0.415
Instability index54.95
Isoelectric point5.26
Molecular weight152711.31
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02639
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.45|      13|      15|      47|      59|       1
---------------------------------------------------------------------------
   47-   59 (21.55/16.21)	ENILARLRATERQ
   63-   75 (20.90/15.47)	NSILAALDVEARQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.20|      12|      15|     671|     682|       2
---------------------------------------------------------------------------
  671-  682 (24.17/12.33)	SMFQRPPSSPSG
  689-  700 (22.03/10.50)	SSSQSPKASDPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      64.22|      17|      21|     460|     480|       3
---------------------------------------------------------------------------
  460-  475 (29.98/16.37)	..D..EEMPDFDD..V.PP..ASGM
  480-  498 (11.46/ 9.51)	DeDlfEEMPD.DS..FgPE..ANG.
  499-  519 (22.77/ 6.21)	D.E..PNWDFFDDpgV.QPkqSRSM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     114.11|      33|     411|     861|     907|       4
---------------------------------------------------------------------------
  861-  901 (52.43/42.90)	PLTANISilNFWDTLNlqpangPKDVTAFCIHPRPANIRDG
 1281- 1313 (61.68/31.39)	PYGANQS..RSMTELN......PSHITGFLLKRRGPRGEDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.58|      40|     196|    1129|    1172|       5
---------------------------------------------------------------------------
 1129- 1172 (59.36/54.01)	RPrHEIFKEmwEVSQDLMSKVRGTWRLAVVRhGYYEPA.EILEWH
 1331- 1371 (70.23/44.42)	KP.NEITAD..ESLEDMIKQYRGLVTLGASR.GCVDPNrECLPWH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     115.34|      31|     329|     380|     433|       7
---------------------------------------------------------------------------
  396-  426 (60.41/43.62)	EGTFDDPEHFQPFGPPAFPASQTIYPTPPDV
 1226- 1256 (54.93/27.04)	QASMTSPDQVVPATPTPGGSSFVNASTPPDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.34|      22|     329|     304|     330|       9
---------------------------------------------------------------------------
  304-  328 (35.73/34.41)	LGRISNGS...QGDLTNAEDalgDPIT....W
  337-  365 (33.61/15.82)	LCFILDGDslvQPSMIDVDD...DPMQfvrdW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.32|      14|      15|     630|     644|      10
---------------------------------------------------------------------------
  630-  644 (22.49/19.84)	YDSPKA..LHSIPiHDS
  646-  661 (21.84/12.97)	YDAEGDywFDPLP.ADS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     142.84|      47|     823|     155|     242|      13
---------------------------------------------------------------------------
  183-  242 (71.27/100.75)	IHLQVVPNGhivlLIAKDNRLSFLP..........IRHCLAGADAGAHNSDF.RAVYLapigriarvSRSK
 1009- 1066 (71.57/29.93)	LQLQVIPQG....FIANEETLVIRPqtaylklaieVYNRLPPLDLAGHPSACgSAVVL.........SRSE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02639 with Med13 domain of Kingdom Fungi
Unable to open file!