<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02632
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAENKDDLSDRAHFDPNWIGYNGGYLHSNNVLFYFATSPFFDQVSGNQSLFTQWVGTPNQNEILGTRARFEANLRHQRGIQYVVEHDPLEEKATVEGPNGQENTNVWVIRKQNRENERDDSVTVLGYYYIVNNVIYQAPSVASILNHRLLNTVSALNKLFNAPADMSLFSVSHGHTYYKPVKPSARQGLSGGAGPQSREGSVVPESRASTAEKPAASSQANEESGGGARTAWEALRMTIAYGKEYSDDMPLVGEPGNFRFSKNKDAAAAAGQTKGHGQTLSSPNGTPGHSRAGSVAALPPSNTAAPPRAVRVGDKPTPVSDGTAKVKRKKSKVEGGSP |
| Length | 338 |
| Position | Head |
| Organism | Phialophora americana |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Phialophora.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.669 |
| Instability index | 34.77 |
| Isoelectric point | 8.87 |
| Molecular weight | 36484.84 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02632
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 114.85| 33| 33| 167| 199| 1
---------------------------------------------------------------------------
167- 199 (59.27/34.04) SLFSVSHGHTYYKPVKPSARQGLSGGAGPQSRE
201- 233 (55.58/31.49) SVVPESRASTAEKPAASSQANEESGGGARTAWE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.60| 19| 33| 238| 259| 2
---------------------------------------------------------------------------
238- 259 (27.53/30.56) TIAYGKEYSDdmPlVGEPGNFR
273- 291 (37.07/25.66) TKGHGQTLSS..P.NGTPGHSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.55| 15| 33| 6| 20| 3
---------------------------------------------------------------------------
6- 20 (29.60/19.53) DDLSDRAHFDPNWIG
42- 56 (24.95/15.43) DQVSGNQSLFTQWVG
---------------------------------------------------------------------------
|