Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MAELTTDQVRSLDQTRQRLLALHKSLVALGSELVTQNQLPSWPALQLHANLVSNNLQTIVSQLAEHRDTYQSTVAFPTPKFPGTQRAFILETLLRTKLEPNVEDWVEEGENISAQQRKATFLGLSDDDRNALWQWAPGAANGAARKQKWGADFTLEEKQKGVENVATGLRRQLIEPPDDEGDEGPEEEEEEYEVSDEEDEDEEADKMDIEKQPPKSEASPASTDTRSALPTAGQMNLETLHKFMTTGR |
Length | 248 |
Position | Head |
Organism | Cladophialophora immunda |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Cladophialophora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.820 |
Instability index | 56.99 |
Isoelectric point | 4.52 |
Molecular weight | 27766.25 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02624 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.02| 18| 29| 104| 121| 1 --------------------------------------------------------------------------- 104- 121 (32.11/20.94) DWVEEGENISAQQRK..ATF 134- 153 (27.90/17.33) QWAPGAANGAARKQKwgADF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEADKMDIEKQPPKS 2) LETLHKFMT 3) LRRQLIEP | 202 237 169 | 216 245 176 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab