<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02614
| Description |
Uncharacterized protein |
| Sequence | MSTDILTQLQTTYDQLLTQFFSTVSYLSQRHPLVAPEPDPSDPYTNPPAQIQQTPNPDGGAAQTSSSGGGLLPGPEDTDRSVYPLRPAAPNVFASAQRELAEDLVTKAQQIEFLISRLPGIGRGEEEQAREIQQLVEKVRQMEVRRKEKRKEMRECVRRLDSVVLGMAQSVDYEEDVNASHPNRAATGG |
| Length | 189 |
| Position | Middle |
| Organism | Exophiala spinifera |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.692 |
| Instability index | 60.25 |
| Isoelectric point | 4.94 |
| Molecular weight | 20904.05 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP02614
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.93| 14| 30| 98| 112| 1
---------------------------------------------------------------------------
98- 112 (18.78/16.78) RELaEDLVTKAQQIE
130- 143 (24.15/16.29) REI.QQLVEKVRQME
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.66| 17| 37| 33| 49| 2
---------------------------------------------------------------------------
33- 49 (33.41/18.29) LVAPEPDPSDPYTNPPA
72- 88 (32.26/17.44) LPGPEDTDRSVYPLRPA
---------------------------------------------------------------------------
|