Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MADDTDQHRDKRPRLDDDGNTDRIEGGAFPTATNHDRQDSMDVDVDEDRGGQVVKTPGGIAAGEMTALEQLQEDMGEPFLLCRSKVERQKPDPQQHLLALYGLGPLLRTVARTDPRTGEKINKLRKSYEGQIKSFGLAGRNKPVKGERNVEEDQPGPLRRMAGSSAWGLQPEEQWNAEHATPKIEVTPDFRAKLKQAMQMQPGTVRNNAYWEDILGFDKPKPNALPPQQKSHPPTPVHVSNGISRQPAQPTAEAKRQTRGKKRSYGDDSFVGYGEGFSDQEDGVDGDDYGGQRKRKKVMMTTTSS |
Length | 305 |
Position | Head |
Organism | Exophiala spinifera |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.115 |
Instability index | 42.31 |
Isoelectric point | 6.35 |
Molecular weight | 33901.26 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02606 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 114.48| 32| 77| 140| 171| 1 --------------------------------------------------------------------------- 140- 171 (57.57/32.30) RNKPVKGERNVEEDQPGPLRRMAGSSAWGLQP 219- 250 (56.91/31.85) KPKPNALPPQQKSHPPTPVHVSNGISRQPAQP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DYGGQRKRKKVMMTTTSS 2) NAYWEDILGFDK 3) QHRDKRPRLD 4) VGYGEGFS | 288 208 7 271 | 305 219 16 278 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab