Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MASHRRGLSQASETVAGSTTTNRNTAATPTRNQGRARAPSTMGRHPPNSVLLYDPSQQEKTTSTTLYLSPDKLRRFPPGSCGPFTSLKLPPKPVEVNAQNPGSPSAATSTPSLVADSPSSASPSTTTTPVANEQASSADFEARSLGKHSSHPGLVFGVRRHSNRDEALAQTVQRKFLDLLAIPSAGNIPQQDSSPVHYETFPQADDMAPVKDPSNVHSTIKDIIQHLYEIQMQTHGYVPETQDLLVDKMTDLAESLAQLQTLTSPRESPHNPIHTVQIAPEIVDYVDDGRNPDIFTRDFVENVQRGNAVINGKQQAFREFSEIYAKALKEGIPGISRQVDAVMESVGFSSEDHEPTKESNLENTKSESAQ |
Length | 370 |
Position | Middle |
Organism | Exophiala spinifera |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.666 |
Instability index | 54.78 |
Isoelectric point | 5.75 |
Molecular weight | 40183.92 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02604 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 137.52| 27| 62| 39| 65| 1 --------------------------------------------------------------------------- 39- 65 (46.12/23.69) PSTMGRHPPNSVLLYD...PSQQEKTTSTT 69- 86 (20.03/ 6.31) .......SPDKLRRFP...PGSCGPFTS.. 104- 128 (37.88/18.20) PSAATSTP..SLVADS...PSSASPSTTTT 142- 171 (33.49/15.28) ARSLGKHSSHPGLVFGvrrHSNRDEALAQT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 140.65| 42| 62| 200| 242| 3 --------------------------------------------------------------------------- 200- 242 (69.57/49.73) TFPQADDMAPVKdPSNVHSTIKDIIQHLYEIQMQTHGYVPETQ 263- 304 (71.08/45.85) TSPRESPHNPIH.TVQIAPEIVDYVDDGRNPDIFTRDFVENVQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) TTSTTLYLSPDKLRRF 2) VLLYDP | 61 50 | 76 55 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab