Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MADQEHQQPQQQQQLPEAPFPAPPPFWRHFTTANEEKLKEIESSEPGRSEKLPIPLAYLRPPPPPPESAEVYTTFGQSQVIDPSKPTSLPRDQLLFDPDSPNLNHAVLLSKMTKSLMLNFLELTSDLSLDPTSYEEKMADIRQLVLNIHVVINMYRPHQARESVKEMLEDILEDGEREMEESDNLKQKVEQFLGELGNTAAHAGSAMATDLNGETSTIGNENPKLDEQRRLWDMIDEMTDG |
Length | 241 |
Position | Middle |
Organism | Exophiala spinifera |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.761 |
Instability index | 61.44 |
Isoelectric point | 4.54 |
Molecular weight | 27313.27 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02602 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.43| 20| 35| 5| 38| 1 --------------------------------------------------------------------------- 5- 25 (37.93/30.81) EHQQPQQQQQLPeAPF.....PAPPP 42- 66 (34.50/ 7.50) ESSEPGRSEKLP.IPLaylrpPPPPP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 62.11| 20| 20| 156| 175| 2 --------------------------------------------------------------------------- 156- 175 (33.76/22.31) RPHQARESVKEMLEDIL.EDG 177- 197 (28.35/17.72) REMEESDNLKQKVEQFLgELG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 32.10| 10| 35| 87| 100| 3 --------------------------------------------------------------------------- 87- 100 (13.64/18.70) TSlprdQLLFDPDS 124- 133 (18.46/10.36) TS....DLSLDPTS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KLDEQRRLWDMIDEMT 2) PPFWRHFTTANEEKLKEIESSEPGRSEKLPIPLAYLRP | 224 24 | 239 61 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab