| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADQEHQQPQQQQQLPEAPFPAPPPFWRHFTTANEEKLKEIESSEPGRSEKLPIPLAYLRPPPPPPESAEVYTTFGQSQVIDPSKPTSLPRDQLLFDPDSPNLNHAVLLSKMTKSLMLNFLELTSDLSLDPTSYEEKMADIRQLVLNIHVVINMYRPHQARESVKEMLEDILEDGEREMEESDNLKQKVEQFLGELGNTAAHAGSAMATDLNGETSTIGNENPKLDEQRRLWDMIDEMTDG |
| Length | 241 |
| Position | Middle |
| Organism | Exophiala spinifera |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.761 |
| Instability index | 61.44 |
| Isoelectric point | 4.54 |
| Molecular weight | 27313.27 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP02602
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.43| 20| 35| 5| 38| 1
---------------------------------------------------------------------------
5- 25 (37.93/30.81) EHQQPQQQQQLPeAPF.....PAPPP
42- 66 (34.50/ 7.50) ESSEPGRSEKLP.IPLaylrpPPPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.11| 20| 20| 156| 175| 2
---------------------------------------------------------------------------
156- 175 (33.76/22.31) RPHQARESVKEMLEDIL.EDG
177- 197 (28.35/17.72) REMEESDNLKQKVEQFLgELG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.10| 10| 35| 87| 100| 3
---------------------------------------------------------------------------
87- 100 (13.64/18.70) TSlprdQLLFDPDS
124- 133 (18.46/10.36) TS....DLSLDPTS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KLDEQRRLWDMIDEMT 2) PPFWRHFTTANEEKLKEIESSEPGRSEKLPIPLAYLRP | 224 24 | 239 61 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab