<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02574
Description |
Uncharacterized protein |
Sequence | MADRLTQLQDALDQLFTQMFASITYIDTRHPASTIPGQVDQHAAVRPPINESGQDAPAPTVDPDTRHIPEEPRRFHATLQELAQDLVLKQAQIEALIESLPGLGNSQEDQEKRIEELEGELKEVQVLREQARIEKERLLSTVEAKILSARRF |
Length | 152 |
Position | Middle |
Organism | Verruconis gallopava |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Venturiales> Sympoventuriaceae> Verruconis.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.595 |
Instability index | 64.02 |
Isoelectric point | 4.85 |
Molecular weight | 17183.10 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP02574
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.66| 13| 36| 27| 43| 1
---------------------------------------------------------------------------
27- 43 (21.08/22.89) DTRHpastIPGQVDQ.HA
64- 77 (22.58/12.96) DTRH....IPEEPRRfHA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.33| 14| 37| 81| 94| 2
---------------------------------------------------------------------------
81- 94 (23.31/14.19) ELAQDLVLK.QAQIE
120- 134 (19.03/10.58) ELKEVQVLReQARIE
---------------------------------------------------------------------------
|