<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02570

Description Uncharacterized protein
SequenceMTSISPAEPRPPSLRRPTDSKRPALGRASSHVFSPIDRKPPALQRETVETGEDRPTKRRKIEAEPNSNQVANNHNISLPAKAPDSHVDTKAVYWRWAKPSAIRAAGAGSKKKQEEENSSEDDAPELPPRPWTTTRAAKVADKPTPTHRSRVDIPVPNTPDSIQVPSSAPQFVPRRPVGFFPWTGKHPEDILNDNNVKNGYFDKPPNPTEKELNTARVPLYNAFKHKSGVDSLSTLFSLVLNQKSKHGLISSVSTFKPPPRVTLTEAKRKSWIADLANADVPLRRLSRTIPQGIKGQTLLEQCLQSSVPLSRAIWFAKCVCANEIRTLKRKGTAPAVAVGAENKWLREWTLNVEQFLETYLEHANPPDWKSNIQYALRLITRLYLENLLDRGHYLDWILRSFTVADVGHTPLWLMVIHIYKQDLSHYRRRGARLAKALIDKYRSIDKLPDQTITPLRQRLRAAIRELLFARPAIFLMPDRWPESVHVVRTCLDTTIGPEGQILEELNRINERAMGFNKAEFLSVRAPDEAIIETLDAARVPYNFALLEEELAGTCSDFDLLLRSCLEWSCTRFRQSNTRLYLVTRLVNRWRRGGRDIDTPILNFLSAFRAGKTTADTQALRHLIAQFSRSDCFPVSKYLQWLMVRGLPEKGTVRIDTGPIFGRTAGVEPPRQPESVQFLLDLSLHRAEDHVINLRNSVLERAGFDPNSEEAIFEQCVRFLEQKLADSSFITKPEPPTLAEPSFASLPWTLRTRISMWLRSRALEAAKLAQSTPMLPGSKILNEEQFFVIRHVLECMEDAAVLADVVGILSVSQRDDLVASLVATTHFHATSFSAIGALEVLQKRMCQVYMNWRPTKPTMPLLTSTLLDLCTAFPVKAPAIRLLQQDLVRGDRGRAVAACSPYSDGIAESLQQAGATFVEDFEAILQSETNMNEQTMNGLFSVLVDRIEKQQKFGDDAHTLHSFCQLLSRLRLCRKTQGDALIQKWMLQLTPRLDLKSGPLLLRILIATGCITFATIFEATIGSKSGPRKNLAVSSLLYQILAPANSTSLDWATYQTRTRWYEYSQREPSTALEILCQAGLQGVSPPFDSLLLVVLVNNWTLDSSSLPDSAKKWLVKSLSLPLKCSDGDLNVAGLQDLLESINVFSHRFVQLRFRLMSPASVEKASGPDQPDLIEVLSQSLKQALQKQSSTHGQEQRFSRLFQIVGPNVASQVRHNVENEFLDALPKLPLGKVTSPPSAVFPSDVQQLSLITEQAFQVCRQDISPSPGFMSHLIDRLSQHLKYLGSVQMTPGTPAPSVTTAPPTVSASSGSSTNMNHSQMMSITSSPNPSTLDMGGGSCPPVGLSYLRYMLQMVCLQRPTLISSGSGGPNAKQAQNEQFQLLVRLASIATHPAMALASGHHGNQEEQIKAKEVVEFACDVIATIIDSVNDEVKMMCAKVLKDKLQDPRLAYLFGSINMMGSLQVQDMGRGLQMVKEGKGIIGEWKPRMWEVLDNGSGKESETSLGLGLFRARYG
Length1512
PositionKinase
OrganismCladophialophora immunda
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Cladophialophora.
Aromaticity0.07
Grand average of hydropathy-0.285
Instability index52.50
Isoelectric point9.05
Molecular weight168534.34
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP02570
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|    1478.23|     500|     564|     181|     744|       1
---------------------------------------------------------------------------
  181-  730 (753.70/625.88)	PWTGKHPEDI.LNDNNVKNGYFDK..PPNPTEKELNTARvplYNAFKH.KSGVDSLSTLFSLV..LNQKSKHGLISS.VST..FKPP..PRVTLTEAKRKSwiadLANADVPLRRLSRTIPqgIKGQTLLEQClqSSVPL.SRAIwfaKCVCANEIRTLKRKGTA..PAVAVGAENKWLREWTLNVEQFlETYLE.HANPPDWKSNIQYALrLITRL.YLENLLDRGHYLD...WILRSFTV..ADVGHTPL..WLMVIhIYKQDLshyrRRGARLAKALI.DKYRSIDKLPDQTI.TPLRQRLRAAIRELLFArpaiFLMPdrwpesvhVVRTCLD.TTIGPEGQILEELNRINERAMG.FNKAEFLSVRAPDEAII.......ETLDAARVPYNFA..LLEE.ELAGTCSDFDL.......LLRSCLEWScTRFRQsnTRLYLVTRlVNRWRRGGRDiDTPILNFLSafRAGKTTADTQALRHLIAQ.FSRsdCFPVSKYLQWLMVRGLPEKGTvrIDTGPIFGRTAGVEPPRQ..PESVQfllDLSLHRAEDHVInLRNSVLERAGF.....DPNSEEAIFEQCVRFLEQKLADSsfIT
  746- 1297 (724.53/489.65)	PWTLRTRISMwLRSRALEAAKLAQstPMLPGSKILNEEQ...FFVIRHvLECMEDAAVLADVVgiLSVSQRDDLVASlVATthFHATsfSAIGALEVLQKR....MCQVYMNWRPTKPTMP..LLTSTLLDLC..TAFPVkAPAI...RLLQQDLVRGDRGRAVAacSPYSDGIAESLQQAGATFVEDF.EAILQsETNMNEQTMNGLFSV.LVDRIeKQQKFGDDAHTLHsfcQLLSRLRLcrKTQGDALIqkWMLQL.TPRLDL....KSGPLLLRILIaTGCITFATIFEATIgSKSGPRKNLAVSSLLYQ....ILAP........ANSTSLDwATYQTRTRWYEYSQREPSTALEiLCQAGLQGVSPPFDSLLlvvlvnnWTLDSSSLPDSAKkwLVKSlSLPLKCSDGDLnvaglqdLLESINVFS.HRFVQ..LRFRLMSP.ASVEKASGPD.QPDLIEVLS..QSLKQALQKQSSTHGQEQrFSR..LFQIVGPNVASQVRHNVENEF..LDALPKLPLGKVTSPPSAvfPSDVQ...QLSLITEQAFQV.CRQDISPSPGFmshliDRLSQHLKYLGSVQMTPGTPAPS..VT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     146.65|      41|      42|      63|     103|       2
---------------------------------------------------------------------------
   28-   59 (43.16/24.78)	........ASSH.VFSPIDRKPPA.LQRETVETGEDRPTKRR
   63-  103 (70.13/45.89)	AEPNSNQVANNH.NISLPAKAPDSHVDTKAVYWRWAKPSAIR
  107-  136 (33.36/17.11)	AGSKKKQEEENSsEDDAPELPPRPWTTTRA............
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.41|      18|      29|    1318|    1335|       3
---------------------------------------------------------------------------
 1318- 1335 (32.65/22.03)	MMSITSSPNPSTLDMGGG
 1348- 1365 (31.76/21.18)	MLQMVCLQRPTLISSGSG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP02570 with Med12 domain of Kingdom Fungi
Unable to open file!