Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSVLDQDQIRALDKTRQLLLSLHTALVALRSEVSQNPGLPSWPALQAHANLLSSNLQTIADQLSTHSESFSSTLVNPLPQFPGKERSFILETLLRTKLEPSTQDWISDGEDIASRQQKQGHVGLAEAERDRLWQWGPHSANMIARGQKWGADYTLEEVRKGIESVRTGLHRELIEPQDEAEDEDEQGDEDEEDEITDDEAEQNPTENDNKMDTRPSDVSTNGAPDKFTLAATSMMPMTSLHRFMSTGH |
Length | 248 |
Position | Head |
Organism | Exophiala mesophila (Black yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Exophiala. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.785 |
Instability index | 51.24 |
Isoelectric point | 4.57 |
Molecular weight | 27769.20 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP02567 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 40.21| 12| 15| 45| 56| 1 --------------------------------------------------------------------------- 45- 56 (19.88/17.42) LQAHANLLSSNL 63- 74 (20.32/17.98) LSTHSESFSSTL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) APDKFTLAATS 2) KMDTRPSDV | 223 210 | 233 218 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab