<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP02566
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MADLKDDLTEKAHFDPNWIAWNGGTLHSNNVLFYFATSPFFDHVSGNQSLFTQWAGTPNQNDILGTRAKFEANLRHQRGIQYVVEHDPLEEQVVFDGPNGPEKSNVWVIRKQNRESGRDDGITVLGYYYIVNNVIYQAPSVASVLNYRLLNTVSALNKVFTAPADLCLFSVSHGYTYHKPIQPSGTQSTLGASQQPNEPPPPTPGPQPSTTEKAASTSQSQDESDDGARTAWDALRMTMQYGKEYVDDMPLVGEPGNFRFSKSKDASTTTGQAKAQGQTSPTGTPGQSRAASVVPPTSSIPSATTKGPKLVEKTATLSDGAAKVKRRKSKPGEPSP |
| Length | 336 |
| Position | Head |
| Organism | Cladophialophora immunda |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae>
Cladophialophora.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.664 |
| Instability index | 37.84 |
| Isoelectric point | 6.66 |
| Molecular weight | 36486.97 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP02566
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.96| 17| 23| 182| 198| 1
---------------------------------------------------------------------------
182- 198 (30.92/16.97) QPSGTQSTLGASQQPNE
207- 223 (29.04/15.55) QPSTTEKAASTSQSQDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.32| 16| 23| 124| 139| 2
---------------------------------------------------------------------------
124- 139 (29.84/23.74) VLGYYYIVN....NVIYQAP
144- 163 (22.48/16.13) VLNYRLLNTvsalNKVFTAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.97| 25| 29| 233| 259| 3
---------------------------------------------------------------------------
233- 259 (38.95/31.16) DALRMTMQyGKEYVDDMPlVGEPGNFR
265- 289 (45.02/26.16) DASTTTGQ.AKAQGQTSP.TGTPGQSR
---------------------------------------------------------------------------
|